KEGG   Bacillus pumilus SH-B9: UP12_05625
Entry
UP12_05625        CDS       T04776                                 
Name
(GenBank) transcriptional regulator
  KO
K05519  transcriptional activator of comK gene
Organism
bpus  Bacillus pumilus SH-B9
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bpus03000]
    UP12_05625
Transcription factors [BR:bpus03000]
 Prokaryotic type
  Other transcription factors
   Others
    UP12_05625
SSDB
Motif
Pfam: Bmp Peripla_BP_4 PP_kinase_C_1
Other DBs
NCBI-ProteinID: AMM96837
LinkDB
Position
1167707..1168669
AA seq 320 aa
MKYQRLVMIFSFLLLLSACSQAPLKGQIEKVGLLVPDTINDQVWGTKGYKGLLNIQSTFG
VDVYYKEGMVDKEKIVDAIEEFHKKGVNLIIGHGNEYSEIFNLISEDYPKTQFITVNGNK
PQADNVANVTFKGEAMGFFGGMTAAHMSKSKKIGILATYDWQSEVDGFIKGAKYQDEHVQ
VLAEFVENWDDADKAVELYQKLKKQGVDVVYPAGDGYNIPVIEQIKADNLSAIGYVTDQS
NLGSHTVLTSTVQHVDKAYGIIAKKFNEGKLNAQGEYSFDFKEGVIEMGKFSSTIDRAFL
KDIESDIATYKKTGKLPNEK
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaagtatcagcggcttgtcatgatcttttcgttccttctcctattatctgcctgctca
caggcacctttaaaaggacagattgagaaggtgggtttactcgtccccgatactattaat
gatcaagtttggggaacgaaaggttataaaggcttattaaatattcaatcaacatttggt
gtagatgtttattataaggaaggaatggtcgacaaagagaaaatcgttgatgccattgaa
gaatttcacaaaaaaggagtcaatttgattattggccatggcaatgaatacagcgaaatt
ttcaatttaatcagtgaagattatccgaaaacacaatttatcacggtaaatggaaacaag
cctcaggcggataatgttgcgaatgtgacgtttaaaggtgaagcgatgggctttttcgga
ggcatgacagcagcacatatgtcaaaatcaaaaaagattggtattcttgctacatatgat
tggcaaagcgaagtagacggctttatcaaaggtgcaaaatatcaagatgaacatgtacaa
gtgcttgctgagtttgtcgaaaactgggatgatgcggacaaagccgtggagctctatcaa
aaattgaaaaaacaaggcgtagatgttgtatatccagcaggtgatggttataatatccct
gtcattgaacaaatcaaagccgataatttatctgcgatcggatatgtcaccgatcaatcc
aacctcggcagccataccgttttaacaagcacagtccagcatgtggataaagcgtacggt
attattgcgaagaaatttaatgaaggcaagctaaatgcacaaggtgagtactcctttgac
tttaaagaaggagtgatcgaaatggggaaatttagttctaccattgaccgtgcttttttg
aaagacattgaaagtgatattgcgacttacaaaaaaactggcaaactgccaaatgaaaag
tga

DBGET integrated database retrieval system