KEGG   Bacillus pumilus SH-B9: UP12_17605
Entry
UP12_17605        CDS       T04776                                 

Definition
(GenBank) bacilysin biosynthesis protein BacA
  KO
K19546  prephenate decarboxylase [EC:4.1.1.100]
Organism
bpus  Bacillus pumilus SH-B9
Pathway
bpus00998  Biosynthesis of various secondary metabolites - part 2
bpus01100  Metabolic pathways
bpus01110  Biosynthesis of secondary metabolites
Module
bpus_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bpus00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    UP12_17605
Enzymes [BR:bpus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.100  prephenate decarboxylase
     UP12_17605
SSDB
Motif
Pfam: PDT
Other DBs
NCBI-ProteinID: AMM99060
LinkDB
Position
3468935..3469537
AA seq 200 aa
MILKNDVFHFKEEPIVSPKMFTVNTLGPKGTSSEYAAKHFISHSTTTLGTHTKLSLYDTF
ETCIEHTLSHALQYTLVPHAYEGIKHFYMRPDLQLLQIFRCDTPMYGLAVRPDFPFHEQM
LHHLKIVSHPAPVNLIQYFIHQNAEFELVNSTSTAAQKVRDGEFDFALTNEVARATYGLT
FVRTFKSIPMSWSIFGKGEI
NT seq 603 nt   +upstreamnt  +downstreamnt
atgatcttaaagaatgatgtttttcatttcaaagaagagcccatcgtttcacctaagatg
tttacagtcaatacactaggccctaaggggacaagcagtgaatacgcagcaaaacatttc
atctctcattccaccactacactcggcactcatacgaaactatccctttacgacacgttc
gaaacttgcattgaacatactctctctcacgcactccaatacactctcgttccacacgca
tacgaaggaatcaaacacttctacatgagacctgacctgcagctcttacaaattttcaga
tgtgacacacccatgtatggtttggctgtcagaccagattttccatttcatgaacaaatg
ctccaccatttaaaaattgtctctcatcctgcacctgtcaatttgattcaatatttcatt
caccaaaatgctgaatttgagctggtcaattcaacaagtactgccgcacaaaaagtaaga
gacggcgaatttgatttcgctttaaccaatgaggtagccagagccacatatggcctcacc
ttcgttcgaacgtttaaaagcatccctatgagctggtccatattcggaaaaggagagata
taa

DBGET integrated database retrieval system