KEGG   Bacillus velezensis YAU B9601-Y2: MUS_1172
Entry
MUS_1172          CDS       T02108                                 
Symbol
med1
Name
(GenBank) transcriptional activator of comK gene
  KO
K05519  transcriptional activator of comK gene
Organism
bqy  Bacillus velezensis YAU B9601-Y2
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bqy03000]
    MUS_1172 (med1)
Transcription factors [BR:bqy03000]
 Prokaryotic type
  Other transcription factors
   Others
    MUS_1172 (med1)
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: AFJ61200
UniProt: I2C3H6
LinkDB
Position
1098969..1099904
AA seq 311 aa
MTFSVLLLLSGCAQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNVDVYYKE
NIRSDEDILKAIDDFHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAKSDNVTS
VHLMGEAMGFFGGMTAAHMSKNNEVGVIASFLWQPEVDGFIKGAKYEKPDITVNTEFTDH
WDNGNEALHLYEKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSNLGKNTVL
TSTVQNVDKAYTLIAEQYNKGTLKSGDHNFDFREGVVEMGTFSPLVDKAFQDKISDLVKT
YNRTNELPSNE
NT seq 936 nt   +upstreamnt  +downstreamnt
atgaccttttctgtcctccttttattgagcggatgcgcacaaactccgtttaaaggaaaa
attgagaaggtcggaatgctttttcccgataccatcagtgacttggtatgggggacaaaa
ggttacaaaggtttattagcgatacaatctgaatttaacgttgacgtttattataaagaa
aatatcagatccgatgaagatattttaaaagcgatagatgattttcataaaaaaggagtc
aatcttttatacgggcacggaaatgaatacgaggaaattttcaatatgatcagcaaggat
tatcccgacatggaattcgtcgtcgcaaacggaacggcgaaaagcgataatgtcacaagc
gttcatcttatgggagaagcaatgggctttttcgggggaatgacggccgcccatatgtca
aaaaacaatgaggtcggcgtcatcgcctcttttttgtggcagcctgaagtagacggcttt
atcaaaggagcgaaatatgaaaagcctgatatcaccgtcaatactgaatttacggaccac
tgggataacggcaatgaagcgctgcatctttacgagaagttaaaagcggaaggcacggat
gttgtatatccggccggagacgggtataatgttcctgtcattcagcaaatcaaaaaagac
gggctttacgccatcggctatgtcgccgagcaatcgaatctcggcaaaaacacggtgctg
acaagcacggtgcaaaacgtagataaagcctatacattaattgccgagcaatataataaa
ggtacgctcaagagcggagatcacaactttgatttcagggaaggagtcgttgaaatgggg
acgttcagccctctggtggacaaagcatttcaagacaaaatctcagaccttgtcaaaacg
tataacagaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system