KEGG   Bacillus velezensis YAU B9601-Y2: MUS_2177
Entry
MUS_2177          CDS       T02108                                 
Symbol
bioI
Name
(GenBank) Biotin biosynthesis cytochrome P450-like enzyme
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bqy  Bacillus velezensis YAU B9601-Y2
Pathway
bqy00780  Biotin metabolism
bqy01100  Metabolic pathways
bqy01240  Biosynthesis of cofactors
Module
bqy_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MUS_2177 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bqy00199]
    MUS_2177 (bioI)
Enzymes [BR:bqy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     MUS_2177 (bioI)
Cytochrome P450 [BR:bqy00199]
 Cytochrome P450, bacteria type
  CYP107 family
   MUS_2177 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AFJ62136
UniProt: I2C662
LinkDB
Position
complement(2122784..2123980)
AA seq 398 aa
MTAGLSIAHPSLHADSDFWNDPYSFYDKLRSIDPVYKGTVLKYPGWYVTGYKEAAAILKD
TRFKNRIPLPEASTKYQNLSHIQHDMLLFKNQSDHKRMRMLIGKEFTAKTAESLRPCIKE
TVHDLLDQVQIKKNADLVSEFAFPLASLIIAEILGVPKEERYQFRQWTADVIQAIDLTRS
RKTLVRASDTAGRLTSYFRDLIHKRKAHPQQDLISRFIMEEQLSKEEVLATCILLVIAGH
ETTVNLMCNGVFTLLKHPEQLSALRENPSLIETAVEECLRYDSPAQLTARTASEDCEING
KTIKKGEQVYILLGAANRDPSIFDQPHKMDIQRKPNPHLAFGKNAHFCIGSSLARIEAQI
AILTLFERMPKLRLAAHRLEYRKLIGFRSLKELPVVIG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcgggcctatcgattgcacatccgtctctccatgcggattcggatttttggaat
gacccttactcgttttatgacaaactgcgatccattgatcctgtttataaagggaccgta
ttaaaatatccgggctggtatgtcaccgggtacaaagaggcggcagcgattctgaaagac
acccgatttaaaaaccgcattcctcttccggaagcttcaacgaaatatcaaaatctatcg
catatccagcacgatatgctgttatttaaaaatcaatcagaccataagcggatgcggatg
cttatcggtaaagaatttaccgcaaagacggcggaatcacttcgcccttgtataaaagaa
acggttcatgacttgttggatcaagtccaaatcaaaaaaaacgctgaccttgtttcagag
tttgcctttccattggcaagccttatcattgcggagatactcggagtgccgaaagaggag
agatatcaattcagacaatggacggcagacgtcattcaggccattgatcttacccgatca
agaaagacgttagtcagagccagcgacaccgcaggcaggctgacgtcatacttcagagat
ttgattcacaagcggaaagctcaccctcagcaagacttgatcagcaggtttattatggag
gaacagctttcaaaagaggaagtgctcgcgacatgtatcttacttgtcatagccggacac
gagacgacggtaaacctcatgtgcaacggtgtgtttactttattgaaacaccctgaacag
cttagcgcactgagagaaaacccctcgcttattgaaactgcagttgaggaatgtttgcgc
tacgacagccccgcgcagctgacggcacgcaccgcttcagaagactgtgaaataaatggg
aagaccataaaaaaaggagagcaggtatatatccttttaggagcagccaatcgcgatcca
agcatattcgatcaacctcacaaaatggatatccaaagaaagccgaatccgcatcttgca
ttcggaaagaacgcccatttttgtataggctcctcattagcgcgtatcgaagcacaaatt
gcaattctcacactgtttgagcggatgcctaagcttcggctggccgcacaccgccttgaa
taccgcaagctcattggttttaggtcgctcaaagagcttccggttgtcattggctga

DBGET integrated database retrieval system