KEGG   Bacillus velezensis YAU B9601-Y2: MUS_2202
Entry
MUS_2202          CDS       T02108                                 
Symbol
fenC
Name
(GenBank) non-ribosomal peptide synthase
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bqy  Bacillus velezensis YAU B9601-Y2
Pathway
bqy01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bqy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    MUS_2202 (fenC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bqy01008]
    MUS_2202 (fenC)
Polyketide biosynthesis proteins [BR:bqy01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    MUS_2202 (fenC)
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AFJ62157
UniProt: I2C683
LinkDB
Position
complement(2155809..2159417)
AA seq 1202 aa
MAEVRQAALEAYEHQDYPFEELVERLGVQRDMSRNPLFDVMFVLQNMERESLGLNKLHLA
QAADTSHKTAKFDATLYASEGSDGSISFDFEFNTDIYQKQTIEKWLSYFTRILTKVIENQ
AIPLGDIHVLDDAETNRVIYQFNQTKSDYPRHETISRLFERQAKETPDARAVVYDGQILT
YRELNERANRIAAALRSNGVGPESVVALLTGRTTELASGILGILKAGGAYLPIGDDVPRE
RAEWMLKDCKADILLQSDKLDGLPLSGKRLFIEDIQTKAGLSSENPEPLGGPESLAYMIY
TSGSTGAPKGVMIEQRSVIRLVKNSNYIDFTPKDRLLFTSSLGFDVTTFEIFGPLLNGAS
LYVSDQETYLDSDVLETFIQQNGITTLWLTSSLFNHLSEQNKDVFSGLSRLIIGGEALSP
SHVNRVRNALPHLSVWNGYGPTENTTFSTCFLIEQSYDHSIPIGRPVGNSTAYIINGRGT
PQPIGVIGELCTGGDGVARGYFGRPELTEEKFVPNPFVPGERMYRTGDLARWLPDGTIEY
AGRMDDQVKIRGYRVELGEIEAALRSLDGVKEAAVSVRTGQSGNKELIAYMSLQADMDTE
KVRSSLSKQLPNYMVPAYMMELEKLPLTPNGKLDRKNLPEPELALQTAYTAPRNELEEQL
SVIWQEVLGTKQVGIEDSFFELGGDSIKALQVSARLGRYGRKMTASDLFRHPSIKELAPL
IRKAERVIDQRPVEGDIPWTPVQHWFLSQRMENRNHFNQSVMMFSSDALHKQPLKEALEH
LVIHHDALRITVSAENESFRQINHGIQKDELYTLDIWDMSGTDTWEREIETEVAALQQRM
DIEKGPLLKAGWFKTRSGDYLFITVHHLAVDGVSWRILLEDLSAAYTQAVKGQPVQLPPK
TDSFKQYAERLSEYAKSSKLMREEEYWRFIEEETAAELPYEKPQHQTGADSIRQTVSFTL
TEEETSVLLQQVNRAYHTDTQDILLTAAALALRDWTGGGRLRIAMEGHGREHIMPELDIS
RTVGWFTSMYPVLIDLNTAGAELGTAVKTVKDTLGRIPDKGIGYGILKYMTPPEQKTIRF
RQAPEISFNYLGQFNDTEDQHTFSLSGLASGHDITPTWQREQAVEMSAMAAQNKLHFSLS
YPPSRFRKETMEQLLQTLQQYLRDIMAHCTGKEEAEKTVSDFSSKTLTSDDLDSIASFVE
EL
NT seq 3609 nt   +upstreamnt  +downstreamnt
ttggcggaagtccgccaggcggcgcttgaggcgtatgagcatcaggactacccgtttgag
gagcttgtggagcggctcggcgtgcagcgggacatgagccgcaatccgctgtttgacgtt
atgtttgtgctccaaaatatggagcgtgaatccctggggttaaataagctgcatttggct
caagctgcggatacaagtcataaaaccgcaaagtttgatgccacgctttacgcgtcagaa
gggtctgacggttccatcagctttgattttgaattcaatacagatatctatcaaaaacag
acaattgaaaaatggctttcttattttacccgtattcttacaaaagtaattgaaaaccaa
gcgataccgcttggtgacattcacgtactggatgatgctgaaacaaatcgcgtcatttat
cagtttaatcagacgaaaagcgattacccaagacacgaaaccatcagccgtttatttgag
cggcaggcaaaagaaacccccgatgcccgggcagttgtatatgatggacaaatcttgaca
taccgtgagctgaacgaacgggctaacagaatagcggcggctctccgatcaaatggcgtc
ggtccggaaagcgttgtcgccttattaaccggccgcacaacagagcttgcttccggaatc
ctcggaatattaaaagcgggaggcgcctacttgcctatcggtgacgatgtgccgcgggaa
cgggctgaatggatgcttaaagactgtaaagctgatattcttctccaatctgataaactt
gacggtctgccgctttcaggaaaacgtttattcatagaggatattcaaacaaaggccggc
ttgagttcggaaaatcccgaaccgctcggcggacctgaatcattggcctacatgatttat
acgtccgggtcaacaggtgcgccaaaaggcgtcatgattgaacagcgaagcgtgatccgc
cttgtgaaaaacagcaattatattgattttacgccgaaagacagactgttgtttacttca
tcattaggatttgacgttacgacatttgaaatattcggtccgcttttaaacggcgcttct
ttatatgtaagtgaccaggaaacctatctcgactctgatgttctggaaacatttatacag
caaaacggcattacgacactgtggctgacatcgtctctgttcaaccatttatcagaacaa
aataaagacgtgttttccggattatcccgattgattatcggcggggaagcactgtccccg
agccatgtaaaccgggttcggaatgcgctgccgcatctctcagtatggaatggatacgga
ccgactgaaaacacgacgttctcgacttgctttttgattgaacaatcatacgatcattca
atcccgatcgggcgccctgtcggaaattcaaccgcatatatcataaacggcaggggaaca
ccgcagccgatcggcgtcatcggcgaattatgcactggcggagacggtgtggcaagagga
tatttcggccgccctgagctgacggaagaaaaatttgtccccaatccttttgttcccgga
gaacggatgtaccgcaccggagatttagcccgctggctgccggacggaacgatcgaatat
gccggacggatggatgatcaagtgaaaatccgcggttatcgggtcgagctgggagagatt
gaagccgcactgaggagcctggacggtgtgaaagaagctgccgtgtcagtcagaaccggg
cagtccggcaataaagaactgatcgcatatatgagtctgcaggcggacatggatacagaa
aaagtgcgttcttcactgtctaagcaactgccgaattacatggttccggcctatatgatg
gaacttgagaagctgccgcttacgccgaacggtaaattggatcggaaaaatctgcccgaa
ccggagctcgcgcttcaaaccgcgtacacagctccccgcaatgagcttgaagaacagctt
tccgtgatctggcaggaagtgctcggcacaaaacaagtcgggattgaggactcatttttt
gagttgggcggcgattcaatcaaagcgctgcaagtttccgcacggctcggacgctatggg
cggaaaatgacggcaagcgacttattccggcatccgtccattaaggagctcgcgccactt
atccggaaagcggaaagagtcatcgatcagcggccggtggaaggagacataccttggaca
cccgttcagcactggtttttatcacagcggatggaaaacagaaatcatttcaatcagtcc
gtcatgatgttcagctctgacgcattgcataaacagccgctcaaagaagccttggagcat
cttgtcattcatcatgatgcactccggatcaccgtcagtgcagaaaacgaaagtttcaga
caaatcaatcacggtattcaaaaagacgaactgtacaccttggacatttgggatatgtct
gggacagatacttgggaaagagaaatagaaactgaagtggctgcgctccaacagcggatg
gatattgaaaaaggcccgttattaaaagccggctggttcaaaacccggtccggagattat
ttattcatcaccgtacatcacctggcggttgacggagtgtcatggcgtattttgctggag
gatttatctgccgcttacactcaagctgtaaaaggtcagccggtccagcttccgccaaag
accgattcgtttaagcaatacgctgaaaggctttcagaatacgcaaaaagcagcaagctg
atgcgtgaagaggaatattggcgttttattgaagaagaaacagccgccgaacttccttat
gaaaaaccgcagcatcagacgggagccgacagcattcggcaaacggtaagctttacgctt
acagaagaagaaacgtccgttttgcttcagcaggtcaaccgggcctaccataccgatacg
caagatattcttctgactgccgcagctttggctttacgggactggacagggggcggcaga
ctgcgcatcgcgatggaagggcacgggagagagcacatcatgccggagctcgacatcagc
cgcaccgtaggctggtttacctccatgtatccggtgctcattgacttgaacacagcaggc
gctgagcttggaacggcggtaaaaacggtcaaagacacactcggaagaataccggataaa
ggaataggctacggcattttaaaatacatgacaccgcctgaacaaaaaacaatccgcttc
agacaagcgcctgaaatcagctttaactatttagggcaattcaatgatacagaagatcag
cacacgttcagtctgtccggtcttgcaagcgggcacgacatcacgccgacatggcagcgg
gaacaagcggtggaaatgagcgcgatggccgcacaaaacaaacttcacttcagtttgagc
tatccgccgagccgcttccgcaaagaaacgatggaacagctgctgcaaactttacagcaa
tatttgcgtgatattatggcgcactgcaccggcaaagaggaagcagaaaaaaccgttagt
gattttagcagcaaaacgttaacatctgatgatttggacagcatagcgagttttgtcgag
gaactgtag

DBGET integrated database retrieval system