Bradyrhizobium sp. NDS-1: RX330_20040 Help Entry RX330_20040       CDS       T11383                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bran  Bradyrhizobium sp. NDS-1 Pathway bran02024   Quorum sensing bran03018   RNA degradation Brite KEGG Orthology (KO) [BR:bran00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     RX330_20040 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     RX330_20040 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bran03019]     RX330_20040 (hfq)    03036 Chromosome and associated proteins [BR:bran03036]     RX330_20040 (hfq) Messenger RNA biogenesis [BR:bran03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      RX330_20040 (hfq) Chromosome and associated proteins [BR:bran03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     RX330_20040 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  WOH70589 LinkDB All DBs Position 4248140..4248388 Genome browser AA seq 82 aa AA seqDB search MAADRAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRRDGHSQLVYKH AISTIMPGAPIQLFEGGEDQPA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcggcagaccgcgcacaaaacctacaggacaccttcctcaatcacgttcgcaaaacc aagacgccactgacgatctttctggtcaacggagtgaagctccagggcattgtgacctgg ttcgacaatttctgtttgctgcttcggcgcgacggtcactcgcagcttgtctacaagcac gcgatctcgaccatcatgccgggcgcaccgattcagttgttcgaaggcggcgaggatcag ccggcttga

DBGET integrated database retrieval system