Breoghania sp. L-A4: D1F64_06165 Help Entry D1F64_06165       CDS       T05594                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism brn  Breoghania sp. L-A4 Pathway brn01100   Metabolic pathways brn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:brn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D1F64_06165   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D1F64_06165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 THF_DHG_CYH_C Motif Other DBs NCBI-ProteinID:  AXS39710 UniProt:  A0A346QZQ1 LinkDB All DBs Position complement(1316698..1316943) Genome browser AA seq 81 aa AA seqDB search MTLSTELLEFLRQQIAQRTKLNIEDISEDSVLMDLGLQSIDAVLLCGDVEDRFQVEMDPA DIFDHETLGAFAKSILQRLAD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacgctatccaccgaactgcttgagttcttgcgccagcagatcgcacagcgcaccaag ctcaatatcgaagacatctccgaggactcggttctcatggatcttgggctccaatcgatc gatgcggtgctgctctgcggcgatgtcgaggaccgtttccaggtcgaaatggatccggcc gatatctttgaccatgaaaccttgggggcatttgccaagtcgattctgcagcgcctggcg gactga

DBGET integrated database retrieval system