KEGG   Candidatus Brocadia sp. Ega_18-Q3-R5-49_MAXAC.112v2: IPI25_10085
Entry
IPI25_10085       CDS       T07026                                 
Name
(GenBank) hydrazine oxidoreductase HzoA
  KO
K20935  hydrazine dehydrogenase [EC:1.7.2.8]
Organism
broc  Candidatus Brocadia sp. Ega_18-Q3-R5-49_MAXAC.112v2
Pathway
broc00910  Nitrogen metabolism
broc01100  Metabolic pathways
broc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:broc00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    IPI25_10085
Enzymes [BR:broc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.8  hydrazine dehydrogenase
     IPI25_10085
SSDB
Motif
Pfam: Multi-haem_cyto Cytochrom_c3_2
Other DBs
NCBI-ProteinID: QQR65897
LinkDB
Position
complement(2208074..2209777)
AA seq 567 aa
MHKFLKLTLASALLGCGAMGVVGNLMTKEAKAVEIITHWVPHEVYGQIGEPDNNGKVFFS
GLGAKYMGYPKHENPPAYPGKYSKFWRTLPAYRYYIPDYMYNRDEVRPSNPIKGTFQLEQ
CIACHSVMTPGIVRDYKKSAHSRAEPSPTGCDTCHGNNHQKLTMPSSKACGTSECHETQY
SEQGQGGIGSHASCSSFAQVECAWSIERPPGDTAGCTFCPTSAEGRCSTCHQRHQFDPKV
ARKSEQCKTCHWGKDHRDWEAYDIGLHGTVYQINKWDPKQFDWTKKLADADYVGPTCQYC
HMRGGHHNVQRFGTVYTSMGMSMADRGAPIWKEKRDRWASVCDDCHSPRFARENLQAMDE
AVKDAGLKYRETFQVAADLVKDGVADPMPKDLCPDWSGQHVWSLKIGAYHDDPAFGGKAG
ESGEFRMSNVSDIERLCFESVGYFQTYIFKGMAHGSWNDATYNDGSFGMDRWLVNIKQDA
TQARRLAALEKKVGITWVPESYWKTGEWLDQLTGPYIVKNHPGKTIFDLCPDPGWLDTHH
APAEEVEYINRKIKELGWATPEHGGHH
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgcataaatttttgaaattaacattagcgtcggcattactaggttgtggagcgatgggg
gtggttggcaacctgatgacgaaagaggcgaaggccgtagaaatcatcacccactgggta
ccacacgaagtgtatgggcagataggcgaaccagataataacggtaaggtattcttttca
ggcttgggtgcaaaatatatgggatacccgaagcacgagaatccgccagcgtatcctgga
aaatatagtaagttctggaggacattacctgcttatcgttattacatcccggactatatg
tacaacagggatgaggtaagaccttccaacccgattaagggtacgttccagttagagcag
tgtattgcctgccattcagttatgacccctggaatcgtaagggattacaagaagagtgcc
cattcaagggctgaaccaagcccaaccggttgtgatacctgccatggcaacaatcatcag
aagctgaccatgccatcatcaaaagcatgcggaacgagcgaatgccacgagacacagtac
agtgagcagggtcagggcggtatcggttcacacgcttcctgttcgagctttgcccaggta
gagtgcgcctggtcaattgaaagaccaccgggagacacggctggttgcacattctgtcct
acaagcgcggaaggaaggtgcagcacttgccaccagaggcatcagtttgatccaaaggtt
gcaagaaagtcagaacagtgcaagacgtgtcattggggtaaggatcacagggattgggag
gcatacgatattggtctccatggtacggtgtatcagataaacaagtgggatccaaagcag
tttgactggacgaagaagttggccgatgcagactatgttggtccgacctgccagtattgc
catatgaggggtggtcatcataacgtacagaggtttggcacggtgtataccagtatgggt
atgtctatggcggatcgtggcgctccaatctggaaagagaagagagaccgttgggcatcc
gtatgcgacgattgtcattcaccaagatttgccagggaaaacctgcaggcaatggatgaa
gccgttaaggatgctggtttgaagtatcgcgaaacatttcaagtggctgcagatcttgtc
aaggatggtgttgcggacccaatgccaaaggatctgtgccctgactggtcaggtcagcac
gtatggagtttgaagatcggcgcttatcatgatgatccggcgtttggaggtaaggctggt
gaatctggcgagttcaggatgtcgaacgtttcagatatagaaaggctgtgctttgagagt
gttggatatttccagacatacatctttaagggtatggcgcatggttcgtggaacgatgcc
acctacaacgatggttcattcggtatggatcgttggctggttaatataaaacaggacgct
actcaggcaaggaggcttgctgctctggagaagaaggttggcatcacttgggttccggaa
agctactggaaaactggcgaatggcttgatcagttgaccggtccttacatcgtaaagaat
catcctggcaagaccatattcgatctgtgtcctgatccaggttggttggatacgcatcat
gctcctgctgaagaagttgagtacatcaacaggaagataaaggaactcggatgggcgact
ccggaacatggcggtcatcactaa

DBGET integrated database retrieval system