KEGG   Brassica rapa (field mustard): 103831884
Entry
103831884         CDS       T03449                                 
Name
(RefSeq) cytosolic sulfotransferase 16
  KO
K11821  aromatic desulfoglucosinolate sulfotransferase [EC:2.8.2.24]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00380  Tryptophan metabolism
brp00966  Glucosinolate biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01210  2-Oxocarboxylic acid metabolism
Module
brp_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    103831884
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    103831884
Enzymes [BR:brp01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.24  aromatic desulfoglucosinolate sulfotransferase
     103831884
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 103831884
NCBI-ProteinID: XP_009106067
LinkDB
Position
A07:complement(26265999..26267453)
AA seq 338 aa
MEPNTTQNGSQLKLSEFEKTQKKYQDFISALPKSKGWRPNEILTQYNGHWWQECLLEGLL
HAKDHFQARPTDFLVCSYPKTGTTWLKALTYAIVNRSRFDDATNPLLKRNPHEFVPYVEI
DFAFYPTVDVLQDGKNQLYSTHIPNGSLPESIMNSGCKMVYIWRDPKDTFISMWTFLHKE
KSQEGQQLASLEEAFDMFCKGLSVYGPYLDHVLGYWKAYKENPERILFLRYETMRADPLP
FVKRLAEFMGYGFSDEEEENGVAENVVKLCSFETLKNLEANKGDKEREDRPAVYANSAYF
RKGKVGDWANYLTPEMAGRIDGLVEETFKDTGLLQHDQ
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggaacccaacacgacccaaaacggatcccaactcaagctctcagagttcgagaaaacc
caaaagaagtaccaagacttcatctccgccctcccaaagagcaaaggatggagaccaaac
gagatcctaacccaatacaacggacactggtggcaagaatgtctcctcgaaggcctcctc
cacgccaaagaccatttccaagcacgacccaccgacttcctcgtctgcagctaccccaaa
accggcacaacctggctcaaagccttaacttacgccatcgtaaaccgttcacgtttcgac
gacgcaacgaacccgctcctcaaacgtaaccctcacgagttcgtgccttacgtcgagata
gacttcgcgttctacccgaccgtggacgtccttcaagacggcaagaaccagctttactcc
acccatatacccaacgggtcgttaccggagtctataatgaactccggttgcaagatggtt
tacatttggagagacccaaaggacacattcatctccatgtggactttcctccacaaggag
aagtctcaagagggtcagcagctagcgagtctcgaagaggcttttgatatgttctgtaaa
ggcttgtctgtgtacggtccttatctggatcatgtgttgggttactggaaggcttacaaa
gagaatccggagaggattctcttcctgaggtacgagacgatgagagctgatcctttgccc
tttgtgaagaggttggctgagttcatgggttatgggtttagtgatgaggaagaggagaat
ggtgttgctgagaatgtagtgaagctttgtagttttgagacgttgaagaatcttgaagct
aacaaaggagataaggagagggaggaccgtcctgcggtttatgcgaatagcgcgtatttt
aggaaaggaaaggttggagattgggcgaattatctgactccggagatggctggtcgtatc
gatgggttagtggaagagacgttcaaagatactggcttgcttcaacatgatcagtga

DBGET integrated database retrieval system