KEGG   Brassica rapa (field mustard): 103863599
Entry
103863599         CDS       T03449                                 
Name
(RefSeq) cytochrome P450 83A1
  KO
K12156  (methylthio)alkanaldoxime N-monooxygenase [EC:1.14.14.43]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00966  Glucosinolate biosynthesis
brp01110  Biosynthesis of secondary metabolites
brp01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    103863599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:brp00199]
    103863599
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.43  (methylsulfanyl)alkanaldoxime N-monooxygenase
     103863599
Cytochrome P450 [BR:brp00199]
 Cytochrome P450, plant type
  CYP83 family
   103863599
SSDB
Motif
Pfam: p450 PCP_red DUF1232
Other DBs
NCBI-GeneID: 103863599
NCBI-ProteinID: XP_009139598
UniProt: A0A397ZQ54
LinkDB
Position
A04:5882924..5884700
AA seq 501 aa
MEDIIIGVVALAAVLLFFLSQKSKTKRYKLPPGPRGLPVIGNLHQLSQVNPQRFFYGWAK
KYGPIFSYKIGSQTMVVISSAELTKELLKTQDANFANRPQHRGHEFITYGRSDMAMNHYT
PYYREMRKMGMNHLFSPTRVATFKHVREEEARTMMAKVEKAAERAEPVDISELMLTFTNS
VVCRQAFGKKYNEDGEEMKRFIKILYGTQSVLGKIFFSDFFPFFGFLDDWTGLTAYMKEC
FERQDTYIQEIIDETLDPNRAKPETESMIDLLMEIYKDQPFASKFTIENVKGVILNIVVA
GTDTAAAAVVWGMTYLMKYPQVMKKAQAEVREYAREKGSTFITEDDVKNLPYFRALVKET
LRIEPVIPLLIPRACIQDTKIAGYDIPAGTTVNVNAWAVSRDEKEWGPNPDEFKPERFLE
KDVDFKGTDYEFIPFGSGRRMCPGMRLGAAMLEVPFANLLLNFNFKLPNGIKPEEINMDV
MTGLAMHKSDHLKLVPEKVSK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggaagatatcatcatcggggtggtggctctagccgcagttctcctcttcttcctctct
caaaaatcaaaaaccaaacgctacaaactgcctcccggcccacgagggcttccggtgatc
ggaaacctccaccagcttagccaggttaacccacagcgtttcttctatggatgggccaaa
aaatacggtccaatcttttcatacaagataggaagtcaaacaatggtggtgatatcatca
gctgagctaaccaaagagcttctcaagacgcaagatgccaacttcgcgaaccggcctcag
caccgtggtcacgagttcataacctacggccgaagtgacatggcaatgaaccactacaca
ccgtattaccgggagatgaggaagatgggaatgaaccacttgttctcacccacacgtgtg
gccaccttcaagcacgtgcgggaggaggaggctaggacgatgatggctaaggtcgaaaag
gctgccgagagagccgaacctgtcgatataagcgagcttatgttgaccttcacgaactcg
gttgtgtgcaggcaagcgttcgggaagaagtacaatgaagatggggaagagatgaagaga
ttcatcaaaattctctatggcactcaaagcgttttggggaagatttttttctccgatttt
tttccgtttttcggatttctagatgattggacaggtctcacggcttatatgaaggagtgt
tttgaaagacaagacacttatatacaggagattattgatgagacacttgaccccaacagg
gccaagccagaaactgagagcatgatcgatctcttgatggagatctacaaagatcaacct
ttcgcctccaagttcactatagagaatgtcaaaggcgtgattttgaatatagtggttgcg
ggaactgacacggcggctgcggcggttgtatggggaatgacgtatttgatgaagtatcct
caagtgatgaagaaagctcaggcagaagtgagagagtatgcaagagagaaaggttcaacg
ttcattactgaagacgacgtgaagaaccttccttacttcagagccttagttaaagaaacc
ttaaggatcgaacctgtgattcctctccttatccctcgtgcttgcattcaagacaccaag
atcgctggttacgacatccctgcggggactactgtcaacgtcaacgcatgggccgtgtcc
cgcgacgagaaggagtggggccctaaccctgacgagttcaaaccagagaggtttcttgag
aaggacgttgacttcaaaggcacggactatgagtttataccgttcggatcaggccggaga
atgtgccctggaatgcggcttggtgcggcgatgcttgaggttcctttcgcgaaccttctc
ctcaacttcaacttcaaacttcccaacggaataaaaccagaagagatcaacatggatgtc
atgactggtcttgctatgcacaagtcggatcatctcaagcttgttcccgagaaagtgagc
aagtaa

DBGET integrated database retrieval system