KEGG   Brassica rapa (field mustard): 103865912
Entry
103865912         CDS       T03449                                 
Name
(RefSeq) cytochrome P450 83A1
  KO
K12156  (methylthio)alkanaldoxime N-monooxygenase [EC:1.14.14.43]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00966  Glucosinolate biosynthesis
brp01110  Biosynthesis of secondary metabolites
brp01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    103865912
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:brp00199]
    103865912
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.43  (methylsulfanyl)alkanaldoxime N-monooxygenase
     103865912
Cytochrome P450 [BR:brp00199]
 Cytochrome P450, plant type
  CYP83 family
   103865912
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 103865912
NCBI-ProteinID: XP_009142022
UniProt: M4DK79
LinkDB
Position
A04:complement(20424217..20426294)
AA seq 502 aa
MEDVIIGVVTIAAVLFFILFQRTKTKRYKVPPGPKALPVIGNLHQLQNLNPQRFFYGWAK
KYGPIFSYKIGSKTMVVISSAELTKELLKTQDVNFSDRPLHRGQEFMSYGRRDMAFHHYT
PYYRDIRKMGMNHLFSPTRVATFKHVREEEARRMMDKIGVAADNSNAVDISELMLTFTNS
VVCRQAFGKKYNEDGEEMKRFIKILYGSQSVFGKVFFSDFFPFTGYVLDDLTRLTAYMKE
CFERQDTYLQEIVDETLDPNRVKPETDSMIDLLMEIYRDQPFASEFTLENVKAVVLDIVV
AGTDTAAAAVVWGMTYLMKYPHVMKKAQAEVREYMRERGLTFVTEDDVKNLPYFRALVKE
TLRIEPVIPLLVPRRCSQNTKIAGYDIPAGTTVNVNAWAVSRDEKEWGPNADEFRPERFF
EKDVDFKGTDYEFIPFGSGRRMCPGMRLGSAMLEVPYANLLYKFDFKLPNGMKPDEINMD
VMTGLAMHKAEHLMLVPEKVNV
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggaagatgtcatcatcggcgtggtgactatcgccgcagttctcttcttcatcctcttc
caaagaaccaaaaccaaacggtacaaggtacctccgggaccaaaggcacttccggtcatc
ggaaacctccaccagcttcagaaccttaacccacaacggttcttctatggatgggccaaa
aaatacggaccaatcttttcatacaagataggaagtaaaacaatggtggtgatatcttct
gctgaactaaccaaagagcttctcaagacgcaagacgtcaacttttcggaccggcctctc
caccgtggccaggagtttatgtcctatggccgacgtgacatggcatttcatcattacaca
ccgtattaccgggacataaggaagatggggatgaaccatttgttctcacccacacgtgtg
gccacctttaagcacgtgagggaggaggaggctaggaggatgatggataagatcggtgtg
gccgctgataactccaacgcggtcgatataagcgagcttatgttgacattcaccaactcc
gttgtatgtagacaagcgttcggtaaaaagtacaatgaagatggggaagagatgaaaagg
ttcatcaagattctttatgggagtcaaagcgtttttgggaaggtttttttctctgatttt
ttcccttttactggctatgttctcgatgatttgacaaggctcaccgcttatatgaaagaa
tgtttcgagagacaagacacttatctgcaagagattgtcgatgaaacacttgatcccaat
agggtcaagcctgaaaccgacagcatgattgacctcttgatggagatctacagagatcaa
cctttcgcctccgagttcactcttgagaatgtcaaagccgtcgtcctggatattgtagtt
gcggggacggacacggcagctgcggcggttgtgtggggaatgacttatctaatgaagtac
cctcatgtgatgaagaaagctcaagcagaagtgagagagtatatgagagagagagggtta
acgttcgtcactgaagacgacgtcaagaaccttccttacttcagagccttagttaaagag
acgctaaggatcgaaccggtgattcctctccttgtccctcgccgttgcagtcaaaacacc
aagatcgctggctacgacatacccgcggggaccacggttaacgtcaatgcatgggccgtg
tcacgtgacgagaaggagtggggaccaaacgctgacgagttcaggcccgagaggtttttt
gagaaggacgttgacttcaaagggacggactacgagtttataccgttcgggtcgggcagg
agaatgtgcccgggaatgcgtcttgggtcagctatgcttgaggttccttatgcgaatctt
ctctataagttcgacttcaaacttcctaatggaatgaagccagatgagatcaacatggat
gtcatgactgggctcgctatgcacaaggccgagcatctcatgcttgtccccgagaaagtg
aacgtgtga

DBGET integrated database retrieval system