KEGG   Brassica rapa (field mustard): 103872656
Entry
103872656         CDS       T03449                                 
Name
(RefSeq) cytosolic sulfotransferase 17
  KO
K22321  aliphatic desulfoglucosinolate sulfotransferase [EC:2.8.2.38]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00966  Glucosinolate biosynthesis
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    103872656
Enzymes [BR:brp01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.38  aliphatic desulfoglucosinolate sulfotransferase
     103872656
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 103872656
NCBI-ProteinID: XP_009149333
UniProt: M4EA61
LinkDB
Position
A06:7518179..7519561
AA seq 337 aa
MESKSENDVVASPPSEFEKNQKHYQETIATLPHQNGWRPKDPFVEYGGHWWLQPLLEGLL
HAQSFFKARPNDFFVCSYPKTGTTWLKALTFAIANRSKFDDSTNPLLKRNPHEFVPYIEI
DFPFFPSVDVLKDEGNTLFSTHIPYNLLPESILKAGCKMVYIWRDPKDTFVSMWTFAHKE
RSQQGDVISIEEAFDKYCHGLSVYGPYLDHVLGYWKAHEANPEQILFLKYETMRGDPLPY
VKRLAEFMGYGFTEEEEEGGVVERVVKLCSFETLKNLEANKGEKDREDRPAVYANSAYFR
KGKVGDWENYLTPEMVARIDGLMEEKFRGTGFLASSP
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggaatccaaatccgaaaacgacgtcgtcgcatcaccaccatcagaattcgagaagaac
cagaaacactaccaagaaaccatcgccacgcttcctcaccaaaacggctggcgcccaaaa
gaccctttcgtcgagtacggtggccactggtggctacaacctctcctcgaaggcttactc
cacgcccaaagcttcttcaaagctcgacccaacgacttcttcgtctgcagctacccgaaa
accggaaccacgtggctcaaggccctaaccttcgcgatcgcgaaccggtccaagttcgac
gactcaacgaaccctctcctcaaacgcaaccctcacgagttcgtgccttacatcgagatc
gacttcccgttcttcccgagcgtggacgtcctcaaggacgaaggcaacacgctcttctcc
actcacatcccttataatctcttgcccgaatcgatcttgaaggctggttgtaagatggtt
tacatttggagagaccccaaggacacgtttgtctccatgtggacgttcgctcacaaggag
aggtcacagcaaggagatgtcattagcatcgaggaggcttttgataagtactgtcacggc
ttgtctgtgtacgggccttatctggatcatgttttgggctactggaaggcccacgaagcg
aacccggagcagattttgtttttgaagtacgagacgatgaggggggacccgttgccgtac
gtgaagaggttagctgagtttatggggtatgggttcacggaggaggaagaggaaggaggg
gttgtggagagagttgtgaagctttgtagctttgagactttgaagaatcttgaagctaat
aaaggggagaaagatagggaggatcgtcctgctgtgtatgcgaacagtgcttattttagg
aaagggaaagttggggactgggagaattatctgacgccggagatggtggctcgtattgat
ggtttgatggaggagaagtttagaggaactggctttcttgcttcatcaccatga

DBGET integrated database retrieval system