KEGG   Bacillus rugosus: M0696_15050
Entry
M0696_15050       CDS       T08218                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bry  Bacillus rugosus
Pathway
bry00780  Biotin metabolism
bry01100  Metabolic pathways
bry01240  Biosynthesis of cofactors
Module
bry_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bry00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    M0696_15050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bry00199]
    M0696_15050
Enzymes [BR:bry01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     M0696_15050
Cytochrome P450 [BR:bry00199]
 Cytochrome P450, bacteria type
  CYP107 family
   M0696_15050
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: UPV78146
UniProt: A0A8U0I5J1
LinkDB
Position
complement(2965343..2966530)
AA seq 395 aa
MTIAFSTASSEFLKNPYPFYETLRAVHPIYKGSFLKYPGWYVTGYEETAVILKDARFKVR
PPLPETSIKYQDLKHVQSQMMLFQNQPDHRRLRTLASGAFTPRMAESYRPYVNETVHHLL
DQVQGEKKMEVISDFAFPLASYVIASIIGVPAVDREQLKEWAASLIQTIDFTRSRKALTE
GNHIAVQAMEYFKDLIQKRKRHPQQDMISMLLKGKEKDKLTEEEAASTCILLAIAGHETT
VNLISNSVLCLLQHPEQLLMLKENPNLIDTAVEECLRYESPTQMTARVASEDIDINGVTI
RRGEQVYLLLGAANRDPNIFTHADDFDITRSPNPHLSFGHGHHVCLGSSLARLEAKIAIH
TLLQRMPGLKLAGSEWQYRPLFGFRALEQLPVTFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgacaattgcattttcaactgcatcttctgagtttttgaaaaatccatatcctttttac
gaaacattgcgcgctgttcatcctatatataaagggagtttcttgaaatacccgggctgg
tatgtcacaggatatgaagaaacggcagttatcctgaaagatgccagattcaaagtccgt
cctccgcttcctgagacgtcaatcaaatatcaggatcttaaacatgtgcaaagtcagatg
atgctgtttcagaatcagcctgatcatagacgattacgcacgctggccagcggagcgttt
acgccgagaatggcagagagctatcgtccgtatgtcaatgaaactgtccatcacttgctt
gatcaagtgcaaggtgaaaaaaagatggaggtgatttcggactttgcttttcctttagcg
agctacgtcatagccagcattataggtgtaccggcggtagatagggagcaattaaaagaa
tgggctgcaagtctcattcaaaccattgattttacccggtcaagaaaggcgttaacagaa
ggcaatcatatcgctgtacaggctatggaatattttaaagatctgattcaaaagcgaaaa
cggcatccgcagcaggacatgatcagcatgctcttgaaggggaaagaaaaggataagctg
acggaagaggaagcggcatctacatgcattttgctggcgatcgccggacatgagacaacg
gttaatctcatcagcaattcagtcctttgtttgctgcagcatcctgaacagcttttgatg
ctgaaagaaaacccaaatcttattgataccgcagttgaggaatgtttacgctatgaaagc
cccacgcaaatgactgccagagttgcatcagaggatattgacatcaacggggtgacgatt
cgtagaggggaacaagtctatcttctgttaggggctgctaatcgagatccaaacatattc
acgcacgccgatgatttcgatataaccagaagccctaatccgcatctttcattcgggcat
ggacatcatgtttgcctaggatcctcactggcacgattagaagcaaagatagcgattcat
acccttctgcagcgaatgcccggcctcaagctcgctggctctgaatggcagtaccggccg
ctttttggcttccgggcgcttgagcagctgccggtgacttttgaataa

DBGET integrated database retrieval system