KEGG   Bipolaris sorokiniana: COCSADRAFT_346574
Entry
COCSADRAFT_346574 CDS       T03124                                 
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
bsc  Bipolaris sorokiniana
Brite
KEGG Orthology (KO) [BR:bsc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    COCSADRAFT_346574
Enzymes [BR:bsc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     COCSADRAFT_346574
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 19137782
NCBI-ProteinID: XP_007704316
JGI: Cocsa1_346574
UniProt: M2RYJ6
LinkDB
Position
Unknown
AA seq 420 aa
MYILPLLLSIHVTSTVAFPWIGNQPGVNPSIFRNAHPVEKRQENCRFNPHHKGAAPYTEP
YTYTGAKNGAPGNQRGGIKVPADGDTAHAYTPPGPNDIRGPCPGLNALANHNFISHDGIT
NFQELVDAQQNVFNVGYDLSVVHTVLGMQAGGDFITGRLSIACDATSRTALFPAFARQPG
LNAHSKFEADSSLTRNDYFLAVGDNYSFNGTLFAQMKKVADEVSGGKFDRNALAKYRSNR
YDDSVSNNPNFLFSPLAIILYGAAAFLYELFPSYGNKGTPDLETMKTFFGAVEDPSAPGG
WRHVPERIPENWFSRVEPYTVTEAATEILAMYLQYPKLFGGNVGISNFNALSTPFGIIRD
GKLPDEVTVKDVLCLLYQLAVSSVPGMFGAVTDIAGAVLNFATSKLNPAFNNTGCPLRVG
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtatatacttccgcttctcctctccatccatgtcacttctactgttgcctttccctgg
atagggaatcagcctggtgtgaaccccagcatcttcaggaacgctcatccggtcgaaaag
cgccaggaaaactgtcgtttcaatcctcatcacaagggcgctgctccatacacagagcct
tacacctacacaggagcaaagaatggcgctcctggtaaccagagaggcggtatcaaagtt
ccagcagacggcgatactgcccatgcttatacccctcctggacccaatgatattcgtggt
ccatgtcccggtttgaatgcactcgcaaaccataattttatttctcacgatggaatcact
aacttccaagagcttgtcgacgctcagcaaaacgtcttcaacgtcggctatgatttatcc
gtcgttcataccgtcctgggcatgcaagctggcggcgatttcattactggccgcttgagt
atcgcatgcgatgctacatcgcgcacagccctctttcctgcttttgcccgccagcccggt
ctcaatgcacacagcaagttcgaggctgattcgtcacttacgcgcaacgactactttctt
gcagttggcgacaactacagttttaacggtacgctgtttgcacagatgaagaaggttgcc
gatgaagtttctggcggaaaattcgatcgcaatgctcttgccaaataccgtagtaaccga
tacgacgattctgtatccaacaacccaaacttccttttcagtcccttggcaataatcctc
tacggagccgcagccttcctttacgaactcttccccagctacggtaacaaaggcactcct
gatctcgagacgatgaagactttctttggtgccgtcgaggacccttctgcgccaggaggc
tggcgtcatgttcccgagcgtatccccgaaaactggttttcgcgcgtcgagccatacaca
gttactgaagccgctaccgagatcctggccatgtatcttcaataccccaagctgtttggt
ggaaatgtcggtattagcaatttcaacgcccttagcacgccatttggtatcatccgcgat
ggaaagctaccggatgaggtgacggtgaaggatgtgttgtgtttgctgtaccagttggcc
gttagctcggtgcctggtatgttcggtgctgtgactgatattgcgggtgcggtcttgaat
tttgcaacctcgaagctgaatcccgcgtttaataacacgggatgtccgcttagggtcggg
tga

DBGET integrated database retrieval system