KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_11300
Entry
BSU6051_11300     CDS       T02503                                 
Symbol
med
Name
(GenBank) positive regulator of comK
  KO
K05519  transcriptional activator of comK gene
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Brite
KEGG Orthology (KO) [BR:bsh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsh03000]
    BSU6051_11300 (med)
Transcription factors [BR:bsh03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU6051_11300 (med)
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_2
Other DBs
NCBI-ProteinID: AGG60482
LinkDB
Position
1206626..1207579
AA seq 317 aa
MITRLVMIFSVLLLLSGCGQTPFKGKIEKVGMLFPDTINDLVWGTKGYKGLLNIQSKYNV
DVYYKEGVKTEEDIINAIEDFHKRGVNLLYGHGSEYAEVFNLVGEDYPDMEFVISNAKAK
ADNVTSVHFSGEAMGFFGGMTAAHMSKTNQVGVIASFTWQPEVDGFIKGAKYENPDIEVN
TKYTDHWDDDTTAVKLYQKMKNEGADVVYPAGDGYNVPVIQQIKKDGLYAIGYVTDQSDL
GENTVLTSTVQNVDKAYEIIAEQFNKGTLEGGDHYYDLNTGVVEMGTFSPLVDQDFQQRI
AKLIKTYNKTGELPKNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcacaaggcttgtcatgatcttttctgtcctccttttattgagtggatgtggacaa
actccgttcaaaggaaaaattgagaaggtcggcatgctctttcctgatacgattaatgac
ctcgtatggggcacaaaagggtataaaggattactgaatatacaatccaaatacaatgtg
gacgtctattataaagaaggcgttaaaacagaagaagatatcataaatgcgattgaggat
tttcataagaggggcgtcaatctgctctacggccatgggagtgaatatgctgaggtgttt
aacttggtcggcgaagattatccagatatggaattcgtcatttccaatgcgaaagcgaaa
gctgataatgtaacaagtgtccattttagcggggaagcaatgggcttttttggaggaatg
actgctgcccatatgtcgaaaacgaatcaggtcggtgtaattgcttcctttacgtggcag
cctgaggttgacggttttatcaaaggggccaagtatgaaaatccggatatagaggtaaat
acgaaatatacggatcattgggatgatgatacaacagcagtaaagctttatcagaaaatg
aagaacgaaggcgcggatgttgtgtatcccgccggagacgggtataatgttcctgttatt
cagcaaatcaaaaaagacggtctttatgccataggctacgtcacagatcaatcggatctg
ggcgagaataccgtattaaccagcacggtgcaaaatgtggacaaggcctatgaaatcatt
gctgaacaatttaataaaggcacccttgagggcggcgatcattactacgacctgaacacg
ggagtcgttgagatgggaacattcagcccgctcgtcgatcaagactttcagcaaagaatc
gccaagctgatcaaaacatacaacaaaacaggcgagctgccaaaaaacgagtaa

DBGET integrated database retrieval system