KEGG   Bacillus siamensis: CWD84_16090
Entry
CWD84_16090       CDS       T06647                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bsia  Bacillus siamensis
Brite
KEGG Orthology (KO) [BR:bsia00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsia03000]
    CWD84_16090
Transcription factors [BR:bsia03000]
 Prokaryotic type
  Other transcription factors
   Others
    CWD84_16090
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: AUJ78241
UniProt: A0A2K9KDJ1
LinkDB
Position
complement(3153818..3154771)
AA seq 317 aa
MITRLVMVFSVLLLLSGCAQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNV
DVYYKENIRSDEDILKAIDDLHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAK
NDNVISVHLIGEAMGFFGGMTAAHMSKTNEVGVIASFLWQPEVDGFIKGAKYEKPDITVN
TEFTDHWDNGNEALHLYKKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSNL
GKNTVLTSTVQNVDKAYTIIAEQYNNGTLKSGDHNFDFREGVVEMGTFSPLVDKAFQDKI
SDLVKTYNRTNELPSNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcaccaggcttgtcatggtcttttctgtcctccttttattgagcggatgcgcacaa
actccgtttaaagggaaaattgagaaggtcggaatgctgtttcccgataccatcagtgac
ctggtatggggcacaaaaggttacaaaggtttattagcgatacaatctgaatttaacgtt
gacgtttattataaagaaaatatcagatctgatgaagatattttaaaagcgatagatgat
ttgcataaaaaaggagtcaatcttttatacgggcacggaaatgaatacgaggaaatcttc
aatatgatcagtaaggattatcccgacatggaattcgtcgtcgctaacggaacggcgaaa
aacgataatgtcataagcgttcatcttataggagaagcgatgggcttttttgggggaatg
acggccgcccatatgtcaaaaaccaatgaggtcggcgtcatcgcctcgtttttatggcag
cctgaggtagacggctttattaaaggggcaaaatatgaaaagcccgatattaccgtcaat
actgaatttacggaccattgggataacggcaatgaagcactgcatctttataagaagtta
aaagcagaaggcacggatgttgtatatccggccggagacgggtataatgttcctgtcatt
cagcaaattaaaaaagacgggctttacgccatcggctatgtcgccgagcaatcgaacctc
ggcaaaaacacggtgctgacaagcaccgtgcaaaatgtagacaaagcctatacaataatc
gccgagcaatataataacggcacgctcaagagcggagatcacaacttcgatttcagggaa
ggagtcgttgaaatggggacgttcagccctctggtggacaaagcatttcaagacaaaatc
tcagaccttgtaaaaacgtataaccgaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system