KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1657
Entry
A7A1_1657         CDS       T02384                                 
Name
(GenBank) Biotin biosynthesis cytochrome P450-like enzyme
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00780  Biotin metabolism
bsl01100  Metabolic pathways
bsl01240  Biosynthesis of cofactors
Module
bsl_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A7A1_1657
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bsl00199]
    A7A1_1657
Enzymes [BR:bsl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     A7A1_1657
Cytochrome P450 [BR:bsl00199]
 Cytochrome P450, bacteria type
  CYP107 family
   A7A1_1657
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AGA22275
LinkDB
Position
1136431..1137618
AA seq 395 aa
MTIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVR
TPLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRATESYQPYIIETVHHLL
DQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAGSLIQTIDFTRSRKALTE
GNIMAVQAMAYFKELIQKRKRHPQQDMISMLLKGREKDKLTEEEAASTCILLAIAGHETT
VNLISNSVLCLLQHPEQILKLRENPDLIGTAVEECLRYESPTQMTARVASEDIDICGVTI
RQGEQIYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVCLGSSLARLEAQIAIN
TLLQRMPSLKLADFEWRYRPLFGFRALEELPVTFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
gtgacaattgcatcatcaactgcatcttctgagtttttgaaaaacccatattctttttac
gacacattgcgagctgttcatcctatctataaagggagtttcttaaaatatccgggctgg
tatgtcacaggatatgaagaaacggctgctattttgaaagatgcgagattcaaagtccgc
accccgctgcctgagagctcaaccaaatatcaggacctttcacatgtgcaaaatcaaatg
atgctgtttcagaaccagcctgatcatagacgattgcggacgcttgccagcggagcgttt
acgccgagagcgacagagagttatcagccgtatatcattgaaactgtccatcatttgctt
gatcaagtgcaaggtaaaaaaaagatggaggtcatttcggactttgcttttcctttagca
agctttgtcatagctaacattataggtgtaccggaggaagatagggagcaattaaaggag
tgggctgggagtctcattcaaacgattgattttacccggtcaagaaaggcattaacagag
ggcaatattatggctgtgcaggctatggcatatttcaaagagctgattcaaaagagaaaa
cgccaccctcaacaggatatgatcagcatgctcttgaaggggagagaaaaggataagctg
acggaagaggaggcggcatctacgtgcatattgctggcgatcgccggacatgagacaacg
gtcaatctcatcagcaattcagtcctttgtctgctgcagcatccagaacagattttgaaa
ctgagagaaaatccagatcttattggtaccgcagtcgaggaatgtttacgctatgaaagc
cccacgcaaatgacagccagagttgcgtcagaggatattgacatctgcggggtgacgatc
cgtcaaggagagcaaatctatcttttgttaggagcggctaatcgagaccctagcatattc
acgaaccccgatgtcttcgatattacgagaagtcctaatccgcacctttcattcgggcat
ggccatcatgtttgcttagggtcctcgctggcacgattagaagcgcaaattgcgattaac
acccttctgcagcgaatgcccagccttaagctcgcggattttgaatggcggtatcggccg
ctttttggatttcgggcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system