KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1712
Entry
A7A1_1712         CDS       T02384                                 
Name
(GenBank) Fengycin synthetase FenC
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    A7A1_1712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsl01008]
    A7A1_1712
Polyketide biosynthesis proteins [BR:bsl01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    A7A1_1712
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AGA22330
LinkDB
Position
2091237..2094695
AA seq 1152 aa
MELDELCLKPAANNGHQTSKFDLTLYAQEQLHGLLTFQMEFSTDLYKKKTIEKWLQYFIN
MLLSIIKDNKAALGTINILNEDETHYLIHELNRTKIDYPRNETISRLFEMQAEQTPNAVA
IVSDTQVFTYEDLNSWANQIASVLQIKGVGPDSVVALLTGRTPELIAGMLGILKAGGAYL
PIASDLPVERIAYMLSDSGAALLLQSEKTEKQLLDIECEQIIIEDIQKQGKTKNVDSSAG
PHSLAYIIYTSGSTGKPKGVMIEQRSVIRLVKNSNYITFTPEDRLLMTSSIGFDVGSFEI
FGPLLNGAALHLSDQQTFLDSHQLKRYIEHQGITTIWLTSSLFNHLTEQNEQTFSQLKHL
IIGGEALSPSHVNRIRNVCPEVSIWNGYGPTENTTFSTCLHIQKTYELSIPIGRPVGNST
AYILNQWGVLQPVGAVGELCVGGDGVARGYLGRPDLTKEKFVPHPFAPGDRLYRTGDLAR
WLPDGTIEYVGRIDDQVKVRGYRVELGEIESALRQIDGVKEAAVLARTGQSGSKELFGYI
SVKAGTNAEQVRSLLARSLPNYMIPAYIIEMEALPLTSNGKLNRKALPEPDFASKQTYIP
PRNELEEQLALIWQEVLGIQRIGIEDSFFELGGDSIKALQVSARLGPYGLSLQVSDLFRH
PKIKDLSPLIRKSERIIEQGPVQGDVPWTPVQQWFFSQDIEERHHFNQSVMLFHSGRLSE
NALRPTLKKLAEHHDALRMVYRNDDRRWIQINQGIHESQLYSLRISDLSQSESGWETQIK
QEVADLQQSINLQEGPLLHAALFKTLTGDYLFLAIHHLVVDGVSWRILLEDLSAGYQQAA
AGQTIQLPPKTDSYQEYARRIQVYAQSSKLIREEAYWRTVEEQQDAELPYEIPHHVNIDF
SKRDSLSFSLTEADTAVLLQNVNHAYGTDTQDILLTAASLAICEWTGGSKLRIAMEGHGR
EHILPELDISRTVGWFTSMYPALISFENHRYELGTALKTVKDTLGRIPNKGVGYGMLKYL
THPENKSITFSKTPEISFNYLGQFNDIERQDTFRPSSLGSGKDITHTWKREQIIEMSAMA
ADKKLHFNLSYPPARFHRNTMEQLINRIEHFLLDIMKHCAGQQKTEKTLSDFSSQSLTAE
DLDSISSLVEEL
NT seq 3459 nt   +upstreamnt  +downstreamnt
ttggagctggatgaactttgtctcaaacctgcagcaaacaatgggcatcaaacgtccaaa
tttgatttaaccctatatgcccaggaacagctccacggtttgctgacgttccaaatggag
tttagtactgacttatataagaaaaaaacgatagaaaagtggcttcaatacttcatcaat
atgttactctccatcatcaaagacaacaaagccgctctcggaacaataaatatcctgaat
gaggatgagacccattaccttatccacgagctcaatcgtacaaaaatagattatccaaga
aatgaaaccatcagcagactctttgaaatgcaggcagaacaaacgcctaatgctgtagca
attgtcagcgacacccaagtattcacttacgaggacctgaacagctgggcaaatcaaatt
gcctcagttctacagataaagggcgtagggcctgatagtgttgtagccttgttgacaggc
agaacaccagaactcattgcaggaatgctgggcattctaaaagccgggggagcctatctg
cctattgcttctgatctgcctgttgaacgaatagcttatatgctgtcagacagcggggcg
gcattactccttcaatctgaaaaaacagaaaaacaactattagacattgaatgtgaacaa
atcataatcgaagatattcaaaagcaaggaaaaacgaagaacgttgattcttcagcaggg
ccacattcactcgcatatatcatttatacctctggatcaaccggtaaaccaaagggtgtc
atgattgagcagcgaagtgtaattcgtcttgttaaaaacagcaattatattacatttaca
cctgaagaccgccttctgatgacatcatcaatcggtttcgacgttgggtcatttgaaatt
ttcggaccgctgctaaatggtgccgctttgcatctgtccgatcaacaaacatttctcgat
tcccatcagcttaagaggtacatagaacatcaaggaatcacaacgatttggctgacatct
tctctattcaatcatttgacagaacaaaatgaacaaacattttcacagctgaaacattta
attataggcggagaagctttgtcgccgagccacgtcaatcgaatcagaaatgtctgccct
gaagtatctatatggaatggatatggccctaccgaaaatacaactttttcgacatgcctt
cacattcaaaaaacatatgaactttccattccgatcgggcggccggttggtaattccacc
gcttatatcttaaatcaatggggagtgctgcagccggtcggagctgtcggtgaactttgt
gtcggcggagatggcgtcgccagaggatatttgggccgtcctgatttaacgaaagagaaa
tttgtcccacatccatttgcacctggcgatcgactgtatcgcacaggtgatctggcgcgc
tggcttcctgatggcacaattgagtacgttggccgtattgatgatcaagtaaaagtcaga
ggctatcgtgtggagctgggtgagatcgaatcagcacttcgccaaatagacggagtcaaa
gaagcggcggtgttggcacgtacaggacagtcagggagcaaagagctgtttggctatatc
agcgtaaaagcaggcacgaatgctgaacaagtgcgttctcttcttgcgcgttcgctgcca
aactatatgatcccggcgtacattattgaaatggaggctcttccgctcacatcaaacggc
aaattgaaccgaaaagcactgcctgaaccagatttcgcatctaaacaaacatacatcccg
ccacgcaacgaacttgaagagcagctggcattgatctggcaggaggttctaggcatccag
aggatcggaatagaggattcattctttgaattgggcggagattcaatcaaagcccttcaa
gtttctgcacgccttgggccctatggactaagcttgcaggtaagtgatttattccgtcat
ccaaagataaaggacttatcaccattgatccgtaagtcagagagaatcatagagcaagga
cccgttcagggagacgttccttggacgccagttcagcaatggtttttttcacaagatatt
gaagaaagacaccatttcaatcagtctgtcatgctattccattctggacgtttgtctgaa
aacgcccttagaccaaccttgaaaaaactggcggagcatcatgatgcgcttcggatggtt
tatcgcaacgatgataggcgatggattcaaatcaaccaaggcattcatgagtcacagcta
tacagcttaagaatctctgatctttcacagtcagaaagcggctgggagacgcaaatcaaa
caagaagttgcagatcttcagcaaagcatcaatttgcaggaaggaccattgttgcacgcc
gctttgtttaaaacactgaccggagattacttgttccttgcgatccatcaccttgtcgtt
gatggtgtctcatggcggattttgcttgaggatttgtcagccggatatcaacaagctgct
gcaggccagacgatccagcttccgcctaaaacggattcctatcaggaatacgcaagacgc
atacaggtatatgcccaaagcagtaagctgattcgcgaagaggcgtattggcgaactgta
gaagaacagcaagacgcagaactgccctatgaaataccgcatcatgtgaacatcgacttc
agcaaaagggactcattaagcttttcactgactgaagcagacaccgccgtcttgctgcaa
aacgtcaatcacgcctatggcacagatacacaagatattctgttaaccgcagcatccttg
gcgatttgtgaatggacaggaggaagcaagctccgtatcgctatggaaggacacgggaga
gaacacattctgccagagttagatatcagcaggacggtcggatggtttacatccatgtat
ccggccctcataagctttgaaaatcataggtatgagctcggaaccgcattaaaaaccgtt
aaagatacactgggccggataccaaacaaaggggtaggttacggtatgctgaaatacctt
acacaccctgaaaataaaagcattacgttttcaaaaacacctgaaatcagctttaactat
ttgggccagttcaacgacatcgaaagacaggacaccttccgcccatcaagccttgggagc
ggaaaggatatcactcatacatggaagcgtgagcaaatcatcgagatgagcgcaatggca
gcagacaaaaagctccatttcaatcttagttatccgccagcccgctttcacagaaacaca
atggagcagcttattaacaggattgaacactttttgctggacattatgaaacactgcgcc
ggtcaacagaaaacagaaaagacactgagcgatttcagcagtcaatcattaacggctgag
gacttggacagcatatccagcttggtggaagaattgtag

DBGET integrated database retrieval system