KEGG   Bacillus smithii: BSM4216_1070
Entry
BSM4216_1070      CDS       T03984                                 
Name
(GenBank) positive regulator of comK
  KO
K05519  transcriptional activator of comK gene
Organism
bsm  Bacillus smithii
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsm03000]
    BSM4216_1070
Transcription factors [BR:bsm03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSM4216_1070
SSDB
Motif
Pfam: Bmp Peripla_BP_4
Other DBs
NCBI-ProteinID: AKP46370
UniProt: A0A0H4P080
LinkDB
Position
1:931888..932865
AA seq 325 aa
MAKKVAVVIIVMILFALLTSCKKEDDKGHLQKVGILVPETINDQVWGTKGYSGMLRIQNR
FGVDVYYKEWMNSKVLTEKAVEEFSHKGVNLIFGHGSEYAEDFNQIASKFPNIHFVSFNG
NAKCKNTTSLKFEGYAMGFFGGMTAAHETKTKKIAVLATYKWQPEIKGFVDGAKYENPDV
QVFKQYVGNWDDTDQALHLLDGLIDKGADVVYPAGDRYSVPVIQKLKEKRLYAIGYVSDQ
SDLGKYTVLTSTVQHVDKLYEVAAARFAEGKLPPGNLYFDFQDGVITMGKWSPVVDKPFR
ERLNRDIAIYTKTGKLPSKSDKGGI
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcaaaaaaagtcgcagttgtaattatagtcatgatcttattcgctttgctaacttct
tgcaagaaagaagatgataaaggacatcttcaaaaagttggaatactggtaccggaaacc
ataaatgatcaagtatggggtacaaaaggatacagtggtatgcttcgcattcaaaaccgt
ttcggtgtggatgtttattacaaagaatggatgaactcaaaagtgctgacggaaaaagca
gtagaggaattttcgcataaaggggttaatttaatttttggacatggaagtgaatatgca
gaagattttaatcaaatagcctctaaatttccaaatatccattttgtcagttttaatggg
aatgccaagtgcaaaaatacgacaagcctcaagtttgaaggttatgctatgggatttttt
ggaggaatgacagccgcccatgaaacaaaaacaaaaaagattgctgttcttgctacctat
aaatggcagccggagatcaaagggtttgtggatggcgccaaatatgaaaatcctgacgtt
caagtgtttaaacaatatgtcggaaattgggatgacacagatcaggcgcttcatttgctt
gatgggctgattgacaaaggggcggatgtcgtgtatccggccggcgaccgctacagtgtc
ccggttattcaaaaattgaaagaaaaaagattatatgccattggctatgtgtctgaccaa
tcggatttgggaaagtatacggtgcttacaagtactgtacagcatgttgataaactttat
gaagtagccgccgcgcgttttgcagaaggaaagcttcctcctggaaatttgtattttgat
tttcaagacggtgtcattacgatgggtaaatggagccccgtggttgataaaccattccga
gaacggttgaatcgcgatatcgccatttataccaaaacaggaaagctgccaagcaaaagt
gataagggaggcatttaa

DBGET integrated database retrieval system