KEGG   Bacillus subtilis BSn5: BSn5_00515
Entry
BSn5_00515        CDS       T01417                                 
Name
(GenBank) plipastatin synthetase
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    BSn5_00515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsn01008]
    BSn5_00515
Polyketide biosynthesis proteins [BR:bsn01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    BSn5_00515
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Transferase
Other DBs
NCBI-ProteinID: ADV92739
LinkDB
Position
complement(100863..108530)
AA seq 2555 aa
MPQQPEIQDIYPLSFMQEGMLFHSLYDEQSRAYFEQASFTINGQLDLERFQKSMDAVFDR
YDIFRTAFIYKNVAKPRQVVLKQRHCPVHVEDISHLNEKDKEHCTEAFKEQDKSRGFDLQ
TDVLMRISILKWAPDHYVCIWSHHHILMDGWCLGIVIKDFLHIYQALGKGQFPDLPPVQP
YGTYIKWLMQQDREEAAEYWKKRLQHFEKASPLPKRTDQMSDGTLQQITFTIPEKETSEL
QKIAAACGATLNTVFQALWGIMLQKFNRRDDAVFGSVISGRPSELKDVENMVGLFINTIP
IRVQSDFLSFSDLVSGMQKDMTEAEAYSYFPLYDIQAQSALKQELIDHIIVFENTPTQQE
IEELNQAGSFDFSVKDFEMEEVTNYRCSVKVIPGRTLYVRIHFHTGTYQPNMMSEIKDYL
QHMISDVISDPSLPVSKMTLLDEDKTRKIVSQNNRTVSVSPKAPTLHGLFERQAAVTPER
PAIRFSGGLLTYAELDMYASRLAAHLAARGVTNESIVGVLSERSPDMLIAVLAVLKAGGA
YLPLDPAYPKERVSYMLKASGASLLLTQPGCSAPNFSGETLEVDMTSLASEKAENHLFTP
ADGGSLAYVIYTSGSTGQPKGVAVEHRQAVSFLTGMQYQFPLSEDDIVMVKTSFSFDASV
WQLFWWALSGASAYLLPPGWEKDSALIVQAIHQEKVTTAHFIPAMLNSFLDQAEMLALGD
GTNLKRVFAGGEPLAPRTAARFASVLPQVSLIHGYGPTEATVDAAFYVLDPERDRDRLRI
PIGKPVPGARLYVLDPHLAVQPSGVAGELYIAGAGVARGYLNRPALTEERFPEDPFYPGE
RMYKTGDVARWLPDGNIEFLGRTDDQVKIRGYRIEPGEIEAALRSVEGVREAAVTVRTGS
GEPELCAYIEGLQRNEVRAQLERLLPGYMVPAYMIEMEQWPVTPSGKLDRNALPAPGVAA
DAETYTAPRNVTEMKLSQLWEDVLKNGPVGIHDNFFDRGGHSLKATALVSRITKEFDVQV
PLKDVFAHPTVEGLAAVIREGTDSPYEAIKPAEKQETYPVSSAQKRIYVLQQLEDGGTGY
NMPAVLELEGKLNPERMGRAFKELIKRHESLRTAFEQDAGGDPVQRIHDEVPFTLQTTVL
GARTEEEAAAAFIKPFDLSQAPLFRAQIVKVSDERHLLLVDMHHIISDGVSVNILIREFG
ELYNNRKLPALRIQYKDYAVWQEGFKTGDAYKTQEVYWLKQLEGELPVLDLPADHARPPV
RSFAGDKVSFTLDQEVASGLHKLARENGSTLYMVLLAAYTAFLSRLSGQEDIIVGSPIAG
RPHKDLEPILGMFVNTLALRTRPEGGKPFVQYLQEVRETALEAFEHQDYPFEELVDKLEL
TRDMSRNPLFDVMFVLQNMDQESLELNELCLKPAAHNGHQTSKFDLTLYTQEQPRGLLTF
QMEFSTDLYKKKTIEKWLQYFINMLLSIIKDNKAALGTINILNEDETHYLIHELNRTKID
YPRNETISRLFEMQAEQTPNAVAIVSDTQVFTYEDLNSWANQIASVLQIKGVGPDSVVAL
LTGRTPELIAGMLGILKAGGAYLPIASDLPVERIAYMLSDSGAALLLQSEKTEKQLLDIE
CEQIIIEDIQKQGKTKNVDSSAGPHSLAYIIYTSGSTGKPKGVMIEQRSVIRLVKNSNYI
TFTPEDRLLMTSSIGFDVGSFEIFGPLLNGAALHLSDQQTFLDSHQLKRYIEHQGITTIW
LTSSLFNHLTEQNEQTFSQLKHLIIGGEALSPSHVNRIRNVCPEVSIWNGYGPTENTTFS
TCLHIQKTYELSIPIGRPVGNSTAYILNQWGVLQPVGAVGELCVGGDGVARGYLGRPDLT
KEKFVPHPFAPGDRLYRTGDLARWLPDGTIEYVGRIDDQVKVRGYRVELGEIETAFRQID
GVKEAAVLARTAQTGSKELFGYISVKAGTNAEQVRSLLACSLPNYMIPAYIIEMENLPLT
SNGKLNRKALPEPDFASKQTYIPPRNELEEQLALIWQEVLGIQRIGIEDSFFELGGDSIK
ALQVSARLGRHGLSLQVSDLFRRPKIKDLSPFIRKTERVIEQGPVQGDVPWTPIQKWFLS
QDIEERHHFNQSVMLFHTDRLSEDALRASLKKLAEHHDALRMVYRNDDRRWIQINQGIHE
SQLYSLRTFDLSQSESGWETQIKQEVADLQQSINLQEGPLLHAALFKTLTGDYLFLAIHH
LVVDGVSWRILLEDLSAGYQQAAAGQTIQLPPKTDSYQEYARRIQEYAQSSKLIREEAYW
RTVEEQQDAELPYEIPHQVNIDFSKRDSLNFSLTEADTAVLLQNVNHAYGTDTQDILLTA
ASLAICEWTGGSKLRIAMEGHGREHILPELDISRTVGWFTSMYPALISFENHRDELGTAL
KTVKDTLGRIPNKGVGYGMLKYLTHPENKSITFSKTPEISFNYLGQFNDIERQDTFRPSS
LGSGKDITHTWKREQIIEMSAMAADKKLHFNLSYPPARFHRNTMEQLINRIEHFLLDIMK
HCAGQQKTEKTLSDFSSQSLTAEDLDSISSLVEEL
NT seq 7668 nt   +upstreamnt  +downstreamnt
atgccgcagcaacctgaaatacaggatatataccctttgtcatttatgcaggaagggatg
ctttttcactcattgtatgatgaacagtcgagagcttattttgaacaggcttcttttacg
atcaatggacagctcgacttggagcgtttccagaaaagtatggatgctgtttttgacagg
tacgatatctttcgaacagcattcatctataaaaatgtagccaaacctcgtcaagtcgtg
ctcaagcaacgtcattgccctgttcatgttgaagatatttctcacctcaatgaaaaagat
aaagaacattgtacagaggcattcaaagagcaggataaatccaggggcttcgatctccaa
acggatgtactgatgagaatatctattttaaaatgggcgcctgatcattatgtctgtatc
tggagccaccatcatattttaatggatggctggtgtttaggcatcgtcattaaagacttt
ctccatatttatcaagcgcttggaaaagggcagtttcctgatttgcctcccgtacagccg
tacgggacgtatattaaatggctgatgcagcaagaccgggaagaagcagctgagtattgg
aaaaagaggcttcagcatttcgaaaaagcttcacctctgcctaaaagaacagatcaaatg
tcggatgggacattacagcagatcacgtttaccattcctgaaaaagaaacctccgaatta
cagaaaatcgctgcagcatgtggtgcgacacttaacactgttttccaagctttatgggga
atcatgctccaaaagttcaatcgccgcgacgatgctgtgttcggatcagttatatcaggc
agaccttctgagctaaaagatgtggaaaacatggtcggactttttatcaataccattcct
attcgagtccaaagtgattttctgtctttttctgacctagtcagcggaatgcaaaaggac
atgactgaagcagaagcgtatagttacttccctttatatgacattcaggcgcagagcgct
cttaaacaagagctgattgatcatattatcgtctttgaaaatacacctactcaacaagag
attgaagagctgaatcaagctggatcatttgatttctccgtgaaagattttgagatggaa
gaggtaactaattatagatgcagtgtcaaagtgatcccagggcgtactttgtacgttcgg
attcattttcataccggcacttatcaaccaaatatgatgtccgaaataaaagattattta
cagcacatgatctctgacgtcatctctgatccatctcttcctgtgtcaaagatgacattg
ctagatgaggacaaaacacggaaaatcgtttctcaaaataacaggacagtatctgtttca
cctaaagcgccaaccctgcatggcctgtttgagcgacaggcggcagtcacaccggagcgg
ccagcgattcgcttttccggcggtttgctgacatacgctgagcttgacatgtacgccagc
cggctggctgcgcaccttgcggcacgcggcgtcacaaacgaaagtatcgtcggtgtcctg
tctgaacgctcacctgacatgctgatcgctgtccttgctgtattgaaggccggaggggcg
tatttgccgcttgatcctgcgtatccaaaggagcgggtgagctacatgctgaaagccagc
ggggcatcgctcttgctgacacagccgggatgctccgcaccaaacttttctggcgaaacg
cttgaagtggacatgacatctcttgcgagcgaaaaagcagaaaaccatctgtttactcct
gctgacggcggttctctcgcctatgtcatctatacatcgggctctaccgggcagccgaaa
ggagtggccgttgagcaccgccaggctgtttcttttctgaccggcatgcagtaccagttt
ccgctttcagaagatgacattgtcatggtgaaaacctctttttcctttgatgcgtctgtg
tggcagctgttttggtgggctctttccggtgcttcggcgtatctgcttccgcccggctgg
gaaaaagactccgcattgatcgtacaagccattcatcaggaaaaagtgacaacggctcat
tttattccggctatgctgaacagctttctcgatcaagcggaaatgttagcgctcggtgac
gggacaaacctaaagcgtgtattcgccggaggtgaaccgcttgcgccgcgtacggcagcc
cgttttgcttctgtattgccgcaggtatcattaatccatggctacgggccgacagaagca
acggtagacgcggcattttacgtgttagatccagaacgggacagggatcgtttgcggatt
ccgattgggaagcccgtacctggtgcgcgtttgtatgttttagatccgcatttagccgta
cagccttccggtgtcgccggcgaactgtacattgccggagcgggtgttgccagaggttat
ttgaatcggccggcattgacggaggagcgttttcctgaagacccgttttacccgggtgaa
cgcatgtacaaaaccggggatgtggcgcgctggctccctgacgggaatattgaattcctc
gggcgcacggatgatcaggtgaaaatccgcggctaccggattgagccgggagaaattgaa
gcggcactaagaagcgttgaaggcgtaagagaggcggctgttaccgtacggacaggcagc
ggggagccggaattatgcgcttatatagaagggctccaaagaaacgaagtgcgggcacag
cttgagagactgttgccgggctacatggtcccagcctatatgatagagatggaacagtgg
ccggttacgccaagcggaaagctcgaccgaaacgccctgccagctcctggcgtagcggca
gatgcggagacctacacagcgccgagaaacgtgactgagatgaagctttctcagctgtgg
gaggacgtgctgaaaaatggccctgtcgggattcacgacaacttttttgaccgcggggga
cattccttaaaagcaacggcgcttgtctcacggatcaccaaagaattcgatgtacaggtg
ccgctaaaagatgtgtttgcccatccgacggtagaagggctggctgccgttatccgtgaa
ggaacggacagtccatatgaagcgattaagcccgctgaaaaacaggaaacctatccggtt
tcctctgcccaaaagcggatttatgtccttcagcagctggaggacggagggacaggctac
aatatgccggctgtgttagagctcgaagggaagctcaaccctgaaaggatgggcagagct
ttcaaagagctgatcaagcgccacgagtcgcttcgaaccgccttcgaacaggacgcagga
ggcgatccggtgcagcgcatccatgacgaggtgccgtttacgttacagactacagttctc
ggcgcacgaaccgaagaggaggccgcagccgcatttatcaaaccgtttgatctcagccaa
gcgccgctgttccgtgctcaaatcgtaaaggtatcagatgagcggcacctgttgctggtt
gatatgcatcacatcatttcagacggtgtttccgtcaacattctgattcgggaattcggc
gagctgtacaataatcggaagcttccggcactgcgcattcaatataaagattatgccgta
tggcaagaaggatttaaaacaggagatgcgtacaaaacgcaagaggtgtactggctgaag
cagctcgagggcgagctgcctgtgctggatctccccgctgatcatgcccgcccgccggtg
cgaagcttcgcgggtgacaaggtctcatttacgctggatcaagaggttgcatcaggcctt
cacaagctggcacgagaaaacggaagcacactgtacatggtgctccttgcggcttacacc
gcgttcttgtcacgcttaagcggacaggaagatatcatcgtcggctcgccaatcgccggc
cggccgcacaaggatcttgagccgatactcggcatgtttgtgaacacgctggcgcttcgg
acgcgtccggagggcgggaagccattcgtacagtatttgcaggaagtgcgtgagacagca
ttggaagcctttgagcaccaggattacccgttcgaagagcttgtcgataagcttgaatta
acacgggatatgagcagaaatccgctgtttgacgtaatgtttgttcttcaaaacatggat
caggaatcgttggagctgaatgaactttgtctcaaacctgcagcacacaatgggcatcaa
acgtccaaatttgatttaaccctatatacacaggaacagccccgcggtttgctgacgttc
caaatggagtttagtactgacttatataagaaaaaaacgatagaaaagtggcttcaatac
ttcatcaatatgttactctccatcatcaaagacaacaaagccgctctcggaacaataaat
atcctgaatgaggatgagacccattaccttatccacgagctcaatcgtacaaaaatagat
tatccaagaaatgaaaccatcagcagactctttgaaatgcaggcagaacaaacacctaat
gctgtagcaattgtcagcgacacccaagtattcacttacgaggacctgaacagctgggca
aatcaaattgcctcagttctacagataaagggcgtagggcctgatagtgttgtagccttg
ttgacaggcagaacaccagaactcattgcaggaatgctgggcattctgaaagccggggga
gcctatctgcctattgcttctgatctgcctgttgaacgaatagcttatatgctgtcagac
agcggggcggcattactccttcaatctgaaaaaacagaaaaacagctattagacattgaa
tgtgaacaaatcataatcgaagatattcaaaagcaaggaaaaacgaagaacgttgattct
tcagcagggccacattcactcgcatatatcatttatacctctggatcaaccggtaaacca
aagggtgtcatgattgagcagcgaagtgtaattcgtcttgttaaaaacagcaattatatt
acatttacacctgaagaccgccttctgatgacatcatcaatcggtttcgacgttgggtca
tttgaaattttcggaccgctgctaaatggtgccgctttgcatctgtccgatcaacaaaca
tttctcgattcccatcagcttaagaggtacatagaacatcaaggaatcacaacgatttgg
ctgacatcttctctattcaatcatttgacagaacaaaatgaacaaacattttcacagctg
aaacatttgattataggcggagaagctttgtcgccgagccacgtcaatcgaatcagaaat
gtctgccctgaagtatctatatggaatggatatggccctaccgaaaatacaactttttcg
acatgccttcacattcaaaaaacatatgaactttccattccgatcgggcggccggttggt
aattccaccgcttatatcttaaatcaatggggagtgctgcagccggtcggagctgtcggt
gaactttgtgtcggcggagatggcgtcgccagaggatatttgggccgtcctgatttaacg
aaagagaaatttgtcccacatccatttgcacctggcgatcgactgtatcgcacgggtgat
ctggcgcgctggcttcctgatggcacaattgagtacgttggccgtattgatgatcaagta
aaagtcagaggctatcgggtggagctgggtgaaatcgaaacagcatttcgtcaaatagac
ggagtcaaagaagccgcagtgttagcacgtacagcccagaccgggagcaaagagctgttt
ggctatatcagcgtaaaagcaggcacgaatgctgaacaagtgcgttcacttctcgcgtgt
tcactgcctaattatatgattccggcgtatatcattgaaatggagaatcttccgctcaca
tcgaacggcaaattgaaccggaaagcactgcctgaaccagatttcgcatctaaacaaaca
tacatcccgccacgcaacgaacttgaagagcagctggcattgatctggcaggaggttcta
ggcatccagaggatcggaatagaggattcattctttgaattgggcggcgattcaatcaaa
gcgcttcaagtttctgcacgtctcgggcgccacgggttaagcttgcaggtaagtgattta
ttccgtcgtccaaagataaaagacttatcaccatttattcgtaaaacagagagagtcata
gaacaaggacctgttcagggagatgttccatggacgcctattcagaaatggtttctctca
caagacatagaagaacgacaccatttcaatcagtctgtcatgcttttccatactgaccgt
ttgtctgaagacgctcttagagcatccttaaaaaagctggcggagcatcatgatgcgctt
cggatggtttatcgcaacgatgataggcgatggattcaaatcaaccaaggcattcatgag
tcacagctatacagcttaagaacctttgatctttcacagtcagaaagcggctgggagacg
caaatcaaacaagaagttgcagatcttcagcaaagcatcaatttgcaggaaggaccattg
ttgcacgccgctttgtttaaaacactgaccggagattacttgttccttgcgatccatcac
cttgtcgttgatggtgtctcatggcggattttgcttgaggatttgtcagccggatatcaa
caagctgctgcaggccagacgatccagcttccgcctaaaacggattcctatcaggaatac
gcaagacgcatacaggaatatgcccaaagcagtaagctgattcgcgaagaggcgtattgg
cgaactgtagaagaacagcaagacgcagaactgccctatgaaataccgcatcaagtgaac
atcgacttcagcaaaagggactcattaaacttttcactgactgaagcagacaccgccgtc
ttgctgcaaaacgtcaatcacgcctatggcacagatacacaagatattctgttaaccgca
gcatccttggcgatttgtgaatggacaggaggaagcaagctccgtatcgctatggaagga
cacgggagagaacacattctgccagagttagatatcagcaggacggtcggctggtttaca
tccatgtatccggccctcataagctttgaaaatcatagggatgagctcggaaccgcatta
aaaaccgttaaagatacactgggccggataccaaacaaaggggtaggttacggtatgctg
aaataccttacacaccctgaaaataaaagcattacgttttcaaaaacacctgaaatcagc
tttaactatttgggccagttcaacgacatcgaaagacaggacaccttccgcccatcaagc
cttgggagcggaaaggatatcactcatacatggaagcgtgagcaaatcatcgagatgagc
gcaatggcagcagacaaaaagctccatttcaatcttagttatccgccagcccgctttcac
agaaacacaatggaacagcttattaacaggattgaacactttttgctggacattatgaaa
cactgcgccggtcaacagaaaacagaaaagacactgagcgatttcagcagtcaatcatta
acggctgaggacttggacagcatatccagcttggtggaagaattgtag

DBGET integrated database retrieval system