KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_09439
Entry
BSNT_09439        CDS       T02607                                 
Symbol
bioI
Name
(GenBank) cytochrome P450 enzyme
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00780  Biotin metabolism
bso01100  Metabolic pathways
bso01240  Biosynthesis of cofactors
Module
bso_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSNT_09439 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bso00199]
    BSNT_09439 (bioI)
Enzymes [BR:bso01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BSNT_09439 (bioI)
Cytochrome P450 [BR:bso00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BSNT_09439 (bioI)
SSDB
Motif
Pfam: p450 Cas_Cas5d
Other DBs
NCBI-ProteinID: BAI86528
UniProt: D4G097
LinkDB
Position
complement(2850998..2852230)
AA seq 410 aa
MMSIAFIFEQKGENHVTIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGY
EETAAILKDARFKVRTPLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRAT
ESYQPYIIETVHQLLDQVQGEKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASL
IQTIDFTRSRKALTEGNHMAVQAMAYFKELIQKRKRHPQQDMISMLLKGKENDKLTEEEA
ASTCILLAIAGHETTVNLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECLRYESPTQMT
ARVASEDIDISGVTIRQGEQVYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVC
LGSSLARLEAQIAINTFLQRMPSLKLADFEWRYRPLFGFRALEELPVTFE
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgatgtcgattgcttttatttttgaacagaaaggagaaaatcacgtgacaattgcatcg
tcaactgcatcttctgagtttttgaaaaacccatattctttttacgacacattgcgagct
gttcatcctatctataaagggagtttcttaaaatacccgggctggtatgtcacaggatat
gaagaaacggctgctattttgaaagatgcgagattcaaagtccgcaccccgctgcctgag
agctcaaccaaatatcaggacctttcacatgtgcaaaatcaaatgatgctgtttcagaac
cagcctgatcatagacgattgcggacgcttgccagcggagcgtttacgccgagagcgaca
gagagttatcagccgtatatcattgaaactgtccaccaattgcttgatcaagtgcaaggt
gaaaaaaagatggaggtcatttcggactttgcttttcctttagcaagctttgtcatcgct
aacattataggtgtaccggaggaagatagggagcaattaaaggagtgggctgcgagtctc
attcaaacgattgattttacccggtcaagaaaggcattaacagagggcaatcatatggct
gtgcaggctatggcatatttcaaagagctgattcaaaagagaaaacgccaccctcaacag
gatatgatcagcatgctcttgaaggggaaagaaaatgataagctgacggaagaggaggcg
gcatctacgtgcatattgctggcgatcgccggacatgagacaacggttaatctcatcagc
aattcagtcctttgtctgctgcagcatccagaacagcttttgaaactgagagaaaatcca
gatcttattggtaccgcagttgaggaatgtttacgctatgaaagccccacgcaaatgaca
gccagagttgcgtcagaggatattgacatcagcggggtgacgatccgtcaaggagagcaa
gtctatcttttgttaggagcggctaatcgagaccctagcatattcacgaaccccgatgtc
ttcgatattacgagaagtcctaatccgcacctttcattcgggcatggccatcatgtttgc
ttagggtcctcgctggcacgattagaagcgcaaattgcgattaacacctttctgcagcga
atgcccagccttaagctcgcggattttgaatggcggtatcggccgctttttggatttcgg
gcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system