KEGG   Bacillus sonorensis: S101395_02964
Entry
S101395_02964     CDS       T06571                                 
Name
(GenBank) Plipastatin synthase subunit
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bson  Bacillus sonorensis
Pathway
bson01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bson00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    S101395_02964
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bson01008]
    S101395_02964
Polyketide biosynthesis proteins [BR:bson01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    S101395_02964
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Transferase
Other DBs
NCBI-ProteinID: ASB89471
LinkDB
Position
complement(2755560..2763233)
AA seq 2557 aa
MPQQPEIQDIYPLSFMQEGMLFHSLYDEQSRAYFEQASFTINGQLDLNRFQKSMDAVFDR
YEIFRTTFIYKNVAKPRQVVLKNRPCRVHFEDLSQLDERDKEHCTEAFKERDKSRGFDLQ
TDVLMRISILKWAPDHYVCIWSHHHILMDGWCLGIVIKDFLCIYQALGEGRLPDLQPVQP
YGTYIKWLMQQDREEAAEYWKKRLQHFEKASPLPKRSNQKSAGILEQVTFTISEKETSAL
QKIAAACGATLNTVFQALWGILLQKINRCDDAVFGSVVSGRPSHLEDVENMVGLFINTIP
IRVQTESHSFSGLVSRMQKDMADAEAYSYYPLYDIQALSTLKQELIDHIIVFENVPTQQE
IEGLNQARSFDFSVENFAMTEETNYGCSVKVIPGRTLYVRINFDPGFYEPGIMAEIKDYV
EHMISTVISDPTLPVSKMTLLDGSKTRNMISECNHTESAFPAAPTLHGLFERQAALTPER
PAIRFAGGSLTYAELDMCASRLAVRLAAHGITKESIVGVLCERSPEMLTAVLAVLKAGGA
YLPLDPTYPQERLSYMLKDSGAALMLTQPGLSLPDVFRETLAVDLTALASEETEQRLFNR
ADSGSLAYVIYTSGSTGRPKGVAVEHRQAVSFLTGMQRQFPLQEDDIIMVKTSFSFDASV
WQLFWWTLSGASAYLLPPGWEKDPALIVKAIQQEGITTAHFIPAMLNSFLDHAEIDALGG
GTSLKRVFAGGEPLAPQTAARFASLLPGVTLIHGYGPTEATVDAAFYVLDSERDRDRLRI
PIGKPVPGARLYVLDPNLAVQPAGVAGELYIAGGGLARGYLNRPELTEERFLADPFYPGE
RMYKTGDLARWLPDGHIEFLGRTDDQVKIRGYRIEPGEIEAALRSIEGVREAAVTVRADG
GEAELCAYAEGLGRNEVRARLERLLPGYMIPAHIIEMEKWPVTPSGKLDRNALPAPDGAA
DQETYTAPKNLTEMKLAQLWEDVLKSGPVGIHDNFFDRGGHSLKATALVSRIAKEFSVQV
ALKDVFAHPTVQGLATVIREGTDSPYEAMKPAEKRETYPVSSAQKRMYVLQQLEDGGTGY
NMPAVLELEGKLDLERLDTVFKQLIKRHESLRTSFEQDAGGEPLQRIHDEVSFTLQTAAL
GEQTEQEAASAFIQPFDLSQAPLFRAQIVKVSDERHLLLVDMHHIISDGVSVNILIREFG
ELYNNRTLPALHIQYKDYAVWQEKFKKGDTYKKQEAYWLKQLEGELPVLDLPADHTRPPV
RSFAGDQVAFTLDEKLKAGLHQLAREHGSTLYMVLLAAYTALLSRLSGREDIIVGSPIAG
RPHKDLEPILGMFVNTLALRTRPEGGKPFAEYLQEVRETALEAYEHQDYPFEELVDQLGV
PRDTSRNPLFDVMFVLQNMDQESVQLENLRLRPATNNGHQVSKFDLTLYAHEDSHGLTTF
QMEFNTDLYKKKTIEKWLQYFINMLRNITQDSEAALGTIHLMDEEETHFLIHELNRTKRE
YPRDETISRLFELQAEQTPDAIAVVSDKQVLTYAELNSRANRIAAVLREKGVGPERVVAL
LTTRTPELAAGMLGILKAGGAYLPIADDLPAERISFMLSDSGAQILLRSEKTENRPLEIE
MECEQIVIENIQGQGETKNLEPLGGPNSLAYIIYTSGSTGKPKGVMIEQRSVIRLVKNSN
YIEFTSEDRLLLTSSIGFDVVTFEIFGPLLNGAALHLSDKETFLDDHQLERYIEHQAITT
MWLTSSLFNHLTEQNEKLFYRLKHLIIGGEALSASHVNRVRHACPELAIWNGYGPTENTT
FSTCFPIDKTYEHSIPIGRPVGNSTAYILNKWGMLQPIGAVGELCVSGDGVARGYLGRPD
LTEEKFVPNPFAPGERMYRTGDLARWLPDGTIEYAGRIDDQVKIRGYRVELGEIESALRH
IDGVKEAAVLVRTGHSGNKELFGYMTLKPGMNAEQVRSHLSRMLPGYMVPPYMIEMDALP
LTLNGKLNRKALPEPDFTSTQSYVPPRNDLEEQLAIIWQDVLGADRIGIEDSFFELGGDS
IKALQVSARLGRCGWSLQASDLFRHPKIKDLSPFIRKTERRIMQGPVQGDVPWTPVQRWF
LSQDIKERHHFNQSVMLFHSGRLSENALRASLQKLAEHHDALRMVYQNDGGQWIQINQGI
HESQLYSLRIFNLSEAEGEWETKIKKEVADLQQSINLQQGPLLHAAWFKTISGDYLFLTI
HHLVVDGVSWRILLEDLSTGYHQAAEGQAIQLPPKTDSYQEYARRIQNYAQSSKLIREQA
YWRIVEEQLAAELPYDIPDHENSHSRERESVSFSLTEEDTAILLQNVNHAYGTDTQDILL
TAATLAIRDWTGGKKLRIAMEGHGREDILPELDISRTVGWFTSMYPVLIDLENQAGDLGT
AVKTVKDTLGRIPNKGVGYGMLKYITQPEHKSITFSKTPDISFNYLGQFNDIEKQGRFRP
SGLGSGKDITHTWKREQVIEISAMAAENKLHFQLSYPPARFHRKTMEQLISIIEHDLQEI
MKHCADKQVAEKTLSDFSSQSLTAEDLDSISNLVEEL
NT seq 7674 nt   +upstreamnt  +downstreamnt
atgccccagcaacccgaaatacaggacatataccctctgtcttttatgcaggaggggatg
ctttttcattcgctgtatgatgaacagtcaagagcttattttgaacaggcgtcatttacg
atcaacggacagcttgacttgaaccgtttccagaaaagtatggacgctgtttttgacaga
tatgaaatcttcagaacgacatttatctataaaaatgtagccaaacctcgtcaagtcgtg
ctcaaaaatcgtccttgccgtgttcattttgaagatctttctcaactcgatgagagagat
aaagaacattgtaccgaagcttttaaagagcgggataaatccagaggcttcgatcttcaa
actgatgtactgatgagaatatcgattttgaaatgggcgcctgatcattatgtttgtatc
tggagccatcatcatattttaatggacggttggtgcttaggcattgtcattaaagacttt
ctctgcatttatcaggcattgggagaagggcgtcttcctgatttgcagccggttcagccg
tatgggacgtatataaaatggctgatgcagcaagaccgtgaagaagcagctgagtattgg
aaaaaaaggcttcagcatttcgaaaaagcttcacctcttcctaaaagaagcaatcaaaag
tcagcagggatattagaacaggttacatttacgatttctgaaaaagagacctccgcattg
cagaaaatcgcagcagcttgcggtgcaacactgaatactgttttccaagctttgtggggg
atcttgctgcaaaaaatcaatcggtgtgacgatgctgtgttcgggtcagttgtatcaggc
aggccgtctcatctggaagatgtagaaaatatggtcggactttttatcaatacgattccc
attcgagtccaaaccgaatcccactctttctctggccttgtcagcaggatgcaaaaggac
atggctgatgcagaagcgtacagctattatccattgtatgatattcaagctctgagcacc
ctgaaacaagagctgatagatcatattatcgtatttgaaaatgtgccgacccagcaagaa
attgaaggactgaatcaggctcgatcgttcgatttctcggttgagaactttgcgatgaca
gaagagaccaactatggatgcagtgtcaaagtcattccagggaggacattgtacgtacgg
atcaattttgatcccggtttttatgaacccggtattatggccgagataaaagattatgta
gagcacatgatctcaactgtcatctctgatccgacccttcctgtatcaaagatgacatta
cttgatggaagcaagacacggaacatgatttctgaatgtaaccacacagaatctgctttt
cctgcagccccgactctgcatggactgtttgaacgccaggcggctttaacacctgagcgg
ccggccatccgctttgccggcggctcgctgacttacgctgagcttgatatgtgcgccagc
cggctggctgtgcgccttgcggcgcacgggatcacgaaggaaagcatcgtcggcgtcctc
tgtgagcggtcgcctgagatgctgacagccgtactcgccgtgctaaaggcgggcggagct
tatttgccgcttgatccgacgtatccgcaggagcggctgagctacatgctgaaagacagc
ggggcagctttgatgctgacacagccgggattatctctacctgatgttttcagggagacg
ctagcggtagatttgacggctcttgcgagtgaagaaacggaacagcgtctgtttaaccga
gcggacagcggttctctcgcctatgttatctatacatctggctcgaccggacggccaaaa
ggcgtggccgttgaacaccgccaggccgtttcctttctgaccggcatgcagcggcagttt
ccgcttcaggaagacgacattatcatggtgaaaacgtccttctcctttgatgcgtctgtc
tggcagctgttttggtggaccctttcaggcgcttcggcttatctgcttccgcccggctgg
gagaaagacccggcattgatcgtaaaagccattcagcaggaagggattacgacggctcat
tttattccggccatgctgaacagctttttagaccatgcggaaatagacgctctgggaggg
gggacaagcctgaagcgtgtcttcgccggaggtgaaccgctagcgccccaaacggcagcc
cgttttgcttctctgttgccgggtgtaacactgattcacggctacgggccgacagaagca
acggtcgatgcggcattttacgttttggattcagagcgggacagggatcgcttgcggatt
ccgatcgggaagcccgtgcccggcgcgcgtctgtatgtcttggatccgaatttggccgta
cagcctgccggcgtcgcgggagagctctacatcgccggaggcggcctcgccagaggctat
ttgaatcgcccggaattaacggaggagcgttttctcgctgatccgttctacccgggtgaa
cgcatgtacaaaaccggggatttggcgcgctggcttcctgacggacatattgaatttctc
ggccgcacggatgatcaggtgaaaatccgcggctaccggattgaaccgggagagattgaa
gcggccctccgaagcatagaaggcgtcagggaagcggccgtaaccgtacgggctgacggc
ggtgaggcggaattatgcgcgtatgcggaagggctcggaagaaacgaagtacgggcgcgg
cttgagagacttctgccgggctacatgatccccgctcatatcattgagatggaaaaatgg
ccggttacgccgagcggaaagcttgaccgaaacgccctgcccgctcctgacggagcggca
gatcaggaaacctacacagcgccaaaaaatctgacggaaatgaagcttgcccagctgtgg
gaggacgtgctgaaaagcggccctgtcgggattcacgacaacttttttgaccggggcggc
cattccttaaaagcgacggcgcttgtttcccggatcgccaaggaattcagcgtacaggtg
gcgctaaaggatgtgtttgcccatccgacagtccaaggtctcgctactgttatccgtgaa
ggaacggacagtccgtacgaagcgatgaagccggctgaaaaacgcgaaacctacccggtg
tcttcagcccaaaagcggatgtatgtccttcagcagctggaggacggaggcacaggctac
aatatgccggccgtgttggagctggaagggaagcttgatcttgaaaggctggatacagta
ttcaaacagctgatcaagcgccatgagtcgcttcggacatcctttgaacaggacgcaggc
ggcgagccgttacagcgcatccatgacgaagtgtcatttacattacagacagcagccctc
ggcgaacaaaccgaacaagaagccgcatccgcgtttattcagccgtttgatctcagccaa
gcccctctgttccgtgcccaaatcgtaaaggtatcagatgagcggcacctgttgctggtt
gatatgcatcacattatttcagacggtgtttccgtcaacattctgattcgggaattcggc
gagctttacaacaaccggacccttccggcgcttcacattcaatacaaagactacgccgta
tggcaggagaagtttaaaaaaggagacacgtacaagaagcaggaagcgtactggctgaag
cagctcgaaggcgagctgcctgtgctggatctgccggctgatcatacccgcccgccggtg
cgaagcttcgcgggtgatcaggttgcatttacgcttgatgaaaagctcaaggccggcctt
caccagctcgcacgtgagcacggaagcaccctgtacatggtgctccttgcggcttacaca
gcgttgttgtcgcgtttgagcggacgggaagacatcatcgtcgggtcgccaattgccggc
cgtccgcacaaggatcttgagccgatactcggcatgtttgtgaacacgctggcgcttcgg
acgcgcccggagggcgggaaaccattcgcggaatatttgcaggaagtgcgtgaaaccgca
ttggaagcctatgagcaccaggattatccgttcgaagagctggtcgatcagctcggcgtg
ccgcgggatacgagccgaaatccgctctttgacgtgatgttcgtgcttcagaatatggat
caagaatccgtgcagctggagaacttgcgtcttcgtcctgcaacaaacaacggacatcag
gtgtcaaagtttgatttaaccctgtatgcacacgaagactcccatggattgacgacattt
caaatggaatttaatactgacttgtataagaaaaagacgatagaaaagtggcttcaatac
ttcatcaatatgttacgcaacatcacacaagacagcgaagccgcacttggaacaatacat
ttaatggacgaggaagagacccatttccttatccatgaactcaacagaaccaaaagagag
tatccaagagatgaaacgatcagccgtctgtttgaattgcaggctgagcaaacacctgac
gccatagctgtggtcagtgataaacaagtattaacttatgcggagctgaacagccgagca
aacagaattgctgcggtgcttcgcgaaaaaggtgtcggacctgagcgtgttgtagctttg
ttgacaacacgaacgccggaacttgccgccggaatgcttggtattctgaaagctggagga
gcctatctgcctatcgctgatgatctgcccgctgaacgaatatcgtttatgctttcagac
agcggcgcccaaatactccttcgatcagaaaaaacagaaaaccgcccgttagaaatagag
atggaatgtgagcaaatcgttatcgaaaacatacaaggacaaggggaaacaaagaatctt
gaacctctaggcgggcccaattcactcgcttatatcatctatacatcgggatcaaccggc
aaaccgaagggggtaatgattgaacagcgaagtgtcatccgccttgtgaaaaacagcaac
tatattgaatttacatctgaagaccggcttctgctgacatcgtctatcggctttgatgtt
gtgacatttgaaatatttggaccgctgttaaatggtgctgctttgcatctgtctgataaa
gaaacttttttagatgaccatcagcttgagaggtacatagaacatcaagcaatcacaaca
atgtggctcacttcttctctattcaaccatttgacagaacaaaacgagaaattattttac
cggctgaaacatctgattatcggcggggaggctctgtcagctagccacgtcaatcgagtt
agacatgcctgcccggaattggccatctggaacggttatggcccgactgaaaatacgact
ttttcaacatgctttcccattgacaagacatatgaacattccattccgatcggacggccg
gttggtaattcgaccgcttatatcttaaataaatggggcatgctgcagccaatcggagct
gtcggtgagctgtgtgtcagcggggatggcgtggcaagaggctaccttgggcgtcctgat
ttaacggaagagaagtttgtgcctaatccttttgcgcctggtgaacgaatgtaccgcaca
ggcgatctggcgcgctggctgccggacggtacgattgaatatgcagggcgcatcgatgat
caggtcaaaatcagaggctatcgggtggagcttggggagatcgaatcagcgcttcgtcat
atagacggggtcaaagaagcggctgtgttggtgcgcacagggcattcgggaaacaaagag
ctattcggctatatgaccttaaaaccgggcatgaatgctgaacaagtacgttcccatctc
tctcgtatgctgccaggctatatggtgccgccatatatgatagaaatggacgctctcccg
ctcacattaaacggaaaattgaaccgaaaagcactgcctgagcctgatttcacatcgaca
caatcgtacgtcccgccgcgcaatgatcttgaagaacagctggccatcatatggcaggat
gttctcggcgctgataggatcggaatagaggattcgttttttgaattaggcggagattca
atcaaagcccttcaagtatccgcacgcctcggccgctgtgggtggagcttgcaagcgagc
gatttattccgccatcccaaaattaaagatttatcaccattcatccgcaagacagaaaga
aggattatgcaaggtcccgttcagggagatgttccatggacgcctgttcagcgctggttt
ctgtcacaagatataaaagaaagacaccactttaaccagtctgtcatgctttttcattct
ggtcgtctgtctgaaaatgcacttcgagcatccctgcaaaagctggcggagcatcatgat
gcgctccgtatggtttatcagaacgacggcggacaatggatacaaatcaaccaaggcatc
catgaatctcaattgtatagcttaagaattttcaatctatcagaagcggaaggcgaatgg
gaaaccaaaataaaaaaagaagttgccgatcttcagcaaagtattaatctgcaacaaggg
ccgttattacatgccgcatggtttaaaacgatatcgggagattacttattcctcacgatc
caccaccttgtagtcgatggtgtgtcatggcggattttgctggaggatttatcaaccgga
tatcatcaggcagcggaaggacaggccatacagcttccgcctaaaacggattcctatcag
gaatacgcaagacgaattcaaaattatgcccaaagcagcaagctgatccgtgaacaggcg
tattggcggattgttgaagagcaattagcggcggaattgccatatgacataccggatcac
gagaattcgcacagtcgggaaagagaatctgtgagcttttcacttactgaagaagacacc
gcaattttgctgcaaaacgtcaaccacgcctacgggacagacacacaagatattctgtta
acggcggctaccttggcgattcgtgactggacaggaggaaaaaaactccgtattgccatg
gaagggcatgggagagaagatattctgcctgagttagatatcagcaggacggtcggatgg
tttacatccatgtaccctgtactcatagacttggaaaatcaagcgggtgatctcggaacc
gctgttaaaaccgttaaagacacactgggccggataccgaacaaaggagtgggatacggc
atgctgaaatacatcacacaacctgaacataaaagcatcacattttcaaaaacacctgac
atcagttttaactacttggggcagttcaatgacatagaaaaacaagggcgtttccggcca
tccggtcttggaagcggaaaggatattactcatacatggaaacgtgagcaggttatagaa
ataagtgcaatggcagcagaaaacaagcttcactttcaacttagctatccgccagcccgc
tttcacagaaagacaatggaacagctcatcagcatcatcgaacacgatttgcaggagatt
atgaaacactgcgctgataaacaggtggcagaaaagacgctaagcgatttcagcagtcaa
tcattaacggcagaggatttggacagtatatccaacttggtggaagaattgtag

DBGET integrated database retrieval system