KEGG   Bacillus subtilis PY79: U712_14985
Entry
U712_14985        CDS       T02937                                 
Name
(GenBank) Biotin biosynthesis cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00780  Biotin metabolism
bsp01100  Metabolic pathways
bsp01240  Biosynthesis of cofactors
Module
bsp_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    U712_14985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bsp00199]
    U712_14985
Enzymes [BR:bsp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     U712_14985
Cytochrome P450 [BR:bsp00199]
 Cytochrome P450, bacteria type
  CYP107 family
   U712_14985
SSDB
Motif
Pfam: p450 Cas_Cas5d
Other DBs
NCBI-ProteinID: AHA78935
LinkDB
Position
complement(2907081..2908313)
AA seq 410 aa
MMSIVFIFEQKGENHVTIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGY
EETAAILKDARFKVRTPLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRTT
ESYQPYIIETVHHLLDQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASL
IQTIDFTRSRKALTEGNIMAVQAMAYFKELIQKRKRHPQQDMISMLLKGREKDKLTEEEA
ASTCILLAIAGHETTVNLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECLRYESPTQMT
ARVASEDIDICGVTIRQGEQVYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVC
LGSSLARLEAQIAINTLLQRMPSLNLADFEWRYRPLFGFRALEELPVTFE
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgatgtcgattgtttttatttttgaacagaaaggagaaaatcacgtgacaattgcatcg
tcaactgcatcttctgagtttttgaaaaacccatattctttttacgacacattgcgagct
gttcatcctatctataaagggagtttcttaaaatacccgggctggtatgtcacaggatat
gaagaaacggctgctattttgaaagatgcgagattcaaagtccgcaccccgctgcctgag
agctcaaccaaatatcaggacctttcacatgtgcaaaatcaaatgatgctgtttcagaac
cagcctgatcatagacgattgcggacgcttgccagcggagcgtttacgccgagaacgaca
gagagttatcagccgtatatcattgaaactgtccatcatttgcttgatcaagtgcaaggt
aaaaaaaagatggaggtcatttcggactttgcttttcctttagcaagttttgtcatagct
aacattataggtgtaccggaggaagatagggagcaattaaaggagtgggctgcgagtctc
attcaaacgattgattttacccgctcaagaaaggcattaacagagggcaatattatggct
gtgcaggctatggcatatttcaaagagctgattcaaaagagaaaacgccaccctcaacag
gatatgatcagcatgctcttgaaggggagagaaaaggataagctgacggaagaggaggcg
gcatctacgtgcatattgctggcgatcgccggacatgagacaacggtcaatctcatcagc
aattcagtcctttgtctgctgcagcatccagaacagcttttgaaactgagagaaaatcca
gatcttattggtaccgcagtcgaggaatgtttacgctatgaaagccccacgcaaatgaca
gccagagttgcgtcagaggatattgacatctgcggggtgacgatccgtcaaggagaacaa
gtctatcttttgttaggagcggctaatcgagaccctagcatattcacgaaccccgatgtc
ttcgatattacgagaagtcctaatccgcatctttcattcgggcatggccatcatgtttgc
ttagggtcctcgctggcacgattagaagcgcaaattgcgattaacactcttctgcagcga
atgcccagccttaatcttgcggattttgaatggcggtatcggccgctttttggatttcgg
gcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system