KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_05710
Entry
BSUW23_05710      CDS       T01302                                 
Symbol
med
Name
(GenBank) transcriptional activator protein Med
  KO
K05519  transcriptional activator of comK gene
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Brite
KEGG Orthology (KO) [BR:bss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bss03000]
    BSUW23_05710 (med)
Transcription factors [BR:bss03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSUW23_05710 (med)
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_2 Peripla_BP_6
Other DBs
NCBI-ProteinID: ADM37195
UniProt: E0U130
LinkDB
Position
1164478..1165431
AA seq 317 aa
MITRLVMIFSVLLLLSGCGQTPFKGKIEKVGMLFPDTINDLVWGTKGYKGLLNIQSKYNV
DVYYKEGVKTDEDIINAIEDFHKRGVNLLYGHGSEYAEVFNLVSEDYPDMEFVISNAKAK
ADNVTSVHFSGEAMGFFGGMTAAHLSKTNQVGVIASFTWQPEVDGFIKGAKYENPDIEVN
TKYTDHWDDDTTAVKLYQKMKNEGADVVYPAGDGYNVPVIQQIKKDGLYAIGYVTDQSDL
GENTVLTSTVQNVDKAYEIIAEQFNKGTLEGGDHYYDLKTGVVEMGTFSPLVDKDFQQRI
AKLIKTYNKTGELPKNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcacaaggcttgtcatgatcttttctgtcctccttttattaagcggttgtggacaa
actccgtttaaaggaaaaattgagaaggtcggcatgctctttcctgatacgattaatgac
ctcgtatggggcacaaaagggtataaaggattactgaatatacaatcaaaatacaatgtg
gatgtctactataaagaaggcgttaaaacagatgaagatattataaatgcaattgaggat
tttcataagcggggtgttaatcttctctatggccatgggagtgaatatgcagaggtgttt
aacttggtcagcgaagattatccagatatggaattcgtcatttctaatgctaaagcaaaa
gctgataatgtgacgagtgtccatttcagcggcgaagcaatgggtttttttggaggaatg
acagctgcccatctgtcgaaaacgaatcaggtcggcgtgattgcttcctttacgtggcag
ccggaggtagacggttttatcaaaggggccaaatatgaaaatccggatatagaagtcaac
acaaaatatacggatcattgggatgatgatacgacagcagtaaagctttatcagaaaatg
aagaacgaaggcgcggatgttgtgtatcctgccggagacgggtataatgttcctgtcatt
cagcaaatcaaaaaagacggcctttatgccatcggttacgtcacagatcaatcggacctg
ggcgagaataccgtattaaccagcacggtgcaaaatgtggacaaggcttatgaaatcatc
gctgagcaattcaacaaaggcacccttgaaggcggcgatcattactacgacctgaaaacg
ggggttgttgaaatgggaacattcagcccgcttgtcgataaagactttcagcaaagaatc
gccaagctgatcaaaacgtacaacaaaacaggcgaactgccaaaaaacgagtaa

DBGET integrated database retrieval system