KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3267
Entry
GYO_3267          CDS       T01635                                 
Symbol
bioI
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00780  Biotin metabolism
bst01100  Metabolic pathways
bst01240  Biosynthesis of cofactors
Module
bst_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    GYO_3267 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bst00199]
    GYO_3267 (bioI)
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     GYO_3267 (bioI)
Cytochrome P450 [BR:bst00199]
 Cytochrome P450, bacteria type
  CYP107 family
   GYO_3267 (bioI)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AEP87869
UniProt: G4NZP0
LinkDB
Position
complement(3026421..3027608)
AA seq 395 aa
MTIAFSTASSAFLKDPYPFYETLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVR
TPLPETSIKYQDLKHVQNQMMLFQNQPDHRRLRTLASGAFTPRMAESYRLYIDETVHHLL
DQVQGEKKMEVISDFAFPLASYVIANIIGVPAEDREQLKEWASILIQTIDFTRSRKALTE
GNHISVQAMAYFRELIQRRKRHPQQDMVSMLLKGKEKDKLTEEEVASTCVLLAIAGHETT
VNLISNSVLCLLQHPQQLLKLKENPDLIDTAVEECLRYESPTQMTARVASEDIDISGVTI
RKGEQVYLLLGAANRDPNIFMQADVFDITRSPNPHLSFGQGHHVCLGSSLARLEAQIAIH
TLLQRMPGLKLADSEWRYRPLFGFRALEELPVTFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgacaattgcattttcaactgcatcttctgcgtttttgaaagacccatatcctttttac
gaaacgttgcgtgctgttcatcctatatataaagggagtttcttgaaatacccgggctgg
tatgtcacaggatatgaagaaacggcagctatcctgaaagatgccagattcaaagtccgg
accccgctccctgagacgtcaatcaaatatcaggatcttaaacatgtacaaaatcagatg
atgctgtttcagaatcagcctgatcatagacgattgcggacgctggccagcggagcgttt
actccgagaatggcagagagctatcgtctgtatatcgatgaaactgtccatcacttgctt
gatcaagtgcaaggtgaaaaaaagatggaggtgatttcggactttgcatttcctttagca
agctacgtcatagctaacattataggcgtaccggcggaagatagggagcaattaaaagaa
tgggcttccattctcattcaaacgattgattttacccggtcaagaaaagcattaacagag
ggcaatcatatctctgtacaggccatggcatattttagagagctgattcaaaggcgaaaa
cggcatccacagcaggatatggtcagcatgctattgaaggggaaagaaaaggataagctg
acagaagaggaagtggcatctacgtgtgtattgctggcgatcgccggacatgagacaacg
gtcaatctcatcagcaattcagtcctttgtctgctgcagcatccacaacagcttctgaag
ctgaaagaaaacccagatcttattgataccgcagttgaggaatgtttacgctatgaaagc
cccacgcaaatgactgcaagagttgcatcagaagatattgacatcagcggggtgacgatt
cgtaaaggggaacaagtctatctgctgttaggggctgccaatcgagatccaaacatattc
atgcaagccgatgtttttgatataaccagaagccctaatccgcatctttcattcggtcag
ggacatcatgtttgcctaggatcctcgctggcacgattagaagcacaaattgcgattcat
accctgctgcagcgaatgcccggcctcaagctcgctgattctgaatggcggtaccggccg
ctttttggctttcgggcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system