Brevundimonas staleyi: ACETK8_11280 Help Entry ACETK8_11280      CDS       T10734                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bsta  Brevundimonas staleyi Pathway bsta02024   Quorum sensing bsta03018   RNA degradation Brite KEGG Orthology (KO) [BR:bsta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     ACETK8_11280 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     ACETK8_11280 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bsta03019]     ACETK8_11280 (hfq)    03036 Chromosome and associated proteins [BR:bsta03036]     ACETK8_11280 (hfq) Messenger RNA biogenesis [BR:bsta03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      ACETK8_11280 (hfq) Chromosome and associated proteins [BR:bsta03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     ACETK8_11280 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  XGJ06663 LinkDB All DBs Position 2226460..2226705 Genome browser AA seq 81 aa AA seqDB search MSQDKRQNLQDTFLNSVRKTKTPLTIFLVNGVKLQGIVTWFDNFCVLLRRDGQSQLVYKH AISTIMPSAPVQLYEPDADED NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtcgcaagacaagcgtcagaaccttcaggacaccttcctcaactccgtccgcaagacc aagaccccgctgaccatcttcctggtgaacggcgtcaagctgcagggcatcgtgacctgg ttcgacaacttctgtgtgctgctccgtcgcgacggccagtctcagctcgtctacaagcac gccatctcgacgatcatgccgtcggctcccgtgcaactgtacgagcccgacgccgacgag gattga

DBGET integrated database retrieval system