KEGG   Bacillus subtilis subsp. subtilis 168: BSU06610
Entry
BSU06610          CDS       T00010                                 
Symbol
pcrA
Name
(RefSeq) ATP-dependent DNA helicase PcrA
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU06610 (pcrA)
   03430 Mismatch repair
    BSU06610 (pcrA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU06610 (pcrA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BSU06610 (pcrA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU06610 (pcrA)
   MMR (mismatch excision repair)
    Other MMR factors
     BSU06610 (pcrA)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 ResIII Terminase_6N Com_YlbF
Other DBs
NCBI-GeneID: 938747
NCBI-ProteinID: NP_388543
Pasteur: BG12834
BSORF: BG12834
UniProt: O34580 A0A6M4JKU6
LinkDB
Position
719370..721589
AA seq 739 aa
MNYISNQLLSGLNPVQQEAVKTTDGPLLLMAGAGSGKTRVLTHRIAYLMAEKHVAPWNIL
AITFTNKAAREMKERVESILGPGADDIWISTFHSMCVRILRRDIDRIGINRNFSILDTAD
QLSVIKGILKERNLDPKKFDPRSILGTISSAKNELTEPEEFSKVAGGYYDQVVSDVYADY
QKKLLKNQSLDFDDLIMTTIKLFDRVPEVLEFYQRKFQYIHVDEYQDTNRAQYMLVKQLA
ERFQNLCVVGDSDQSIYRWRGADITNILSFEKDYPNASVILLEQNYRSTKRILRAANEVI
KNNSNRKPKNLWTENDEGIKISYYRGDNEFGEGQFVAGKIHQLHSTGKRKLSDIAILYRT
NAQSRVIEETLLKAGLNYNIVGGTKFYDRKEIKDILAYLRLVSNPDDDISFTRIVNVPKR
GVGATSLEKIASYAAINGLSFFQAIQQVDFIGVSAKAANALDSFRQMIENLTNMQDYLSI
TELTEEILDKTEYREMLKAEKSIEAQSRLENIDEFLSVTKNFEQKSEDKTLVAFLTDLAL
IADIDQLDQKEEESGGKDAITLMTLHAAKGLEFPVVFLMGLEEGVFPHSRSLMEEAEMEE
ERRLAYVGITRAEQELYLTNAKMRTLFGRTNMNPESRFIAEIPDDLLENLNEKKETRATS
ARKMQPRRGPVSRPVSYASKTGGDTLNWAVGDKAGHKKWGTGTVVSVKGEGEGTELDIAF
PSPVGVKRLLAAFAPIEKQ
NT seq 2220 nt   +upstreamnt  +downstreamnt
ttgaattatattagcaatcaattactaagcggtttaaaccccgttcagcaggaagcagtc
aaaacaacggacgggcctcttttgctgatggcgggagcgggtagcggaaagacgcgtgtc
ctgacccatagaattgcttatttaatggcagaaaagcatgtggcgccgtggaacattctg
gcgatcacatttacaaataaagcggcacgcgaaatgaaagaacgtgtggaaagcatcctc
ggacccggcgcggacgatatctggatctccacattccacagcatgtgcgtgcggatcttg
cgcagagatatcgaccggattgggatcaaccgaaatttctccatccttgatacggctgac
cagctttcagtgatcaaggggattttgaaggagcgcaatcttgatccgaagaagtttgac
ccgagaagcatcctcggcacgatcagcagtgcaaaaaacgaattgaccgaaccggaggaa
ttctctaaagttgctggcggctactacgatcaggtggtcagcgatgtatatgctgattat
cagaagaagctattgaaaaaccagtcgctcgatttcgacgatttaattatgacgacgatt
aaactgtttgacagagtgcctgaagtgcttgaattttatcagcgcaaattccagtacatc
cacgttgatgagtatcaggatacgaacagggcacaatacatgctcgttaagcagcttgcc
gagcgtttccagaacctttgcgttgtgggggattctgatcagtcaatctacagatggcgc
ggcgcggatatcaccaacattctttcatttgaaaaagattatccgaatgcaagcgtgatt
ttgctagaacaaaactatcgttcaacgaaacggattttgcgcgcggctaacgaggtcatt
aaaaacaactctaaccgcaaaccgaaaaatttgtggacggaaaatgatgaaggcatcaag
atttcctattatcgcggtgataatgagttcggtgaaggacagtttgtggccggcaaaatt
catcagcttcacagcacaggcaagcggaagctgtcggatatcgccatattataccggaca
aacgcgcagtcccgtgtgattgaggaaacgcttctcaaagcgggcttgaactataacatt
gtcggcggcacaaagttctatgacagaaaagaaattaaagacattcttgcgtacctgcgc
ctcgtatccaatccggatgacgatatcagtttcacgcgcattgtcaatgtgccgaagcgc
ggagtcggcgcgacatcacttgaaaaaatcgcttcgtatgcggccataaacggcttgtcc
tttttccaagcgattcagcaggttgattttatcggcgtcagtgccaaagcggcaaacgcg
cttgacagctttagacagatgattgaaaacctgaccaatatgcaggattacttatccatt
acagagctgacagaagaaattcttgataagacggaatacagagaaatgctgaaggctgag
aaatcgatcgaagcccaaagccgtttagaaaatatcgacgagttcctgtctgttacgaaa
aactttgaacagaaaagtgaagacaagacactcgttgcgttcctgacagacttggcattg
atcgcagatattgatcagctcgatcagaaggaggaagagtcaggcggcaaggatgcgatc
accctgatgacactgcacgccgcgaaaggactggagtttccggttgttttcttgatgggg
cttgaagaaggcgtcttcccgcatagccgttcactcatggaggaagcggaaatggaagaa
gaacgccgccttgcgtacgttgggattacaagggcggaacaggagctttatctgaccaat
gctaaaatgcgcaccttgtttggccggacaaatatgaacccggaatctcgcttcattgct
gaaataccggatgatttattggaaaacctaaatgagaaaaaagaaacaagagcgacgtct
gcgagaaaaatgcagccgagacgcggccctgtttcacgcccggtatcctacgccagcaaa
acaggcggcgacaccttgaactgggcagtcggagataaggcgggccataaaaaatgggga
acaggaactgtcgtcagcgtgaaaggcgaaggagaagggacagagcttgatattgccttc
ccgagccctgtcggcgtgaaacgcctgttagcagcatttgctcctattgaaaagcagtaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU11820
Entry
BSU11820          CDS       T00010                                 
Symbol
yjcD
Name
(RefSeq) ATP-dependent DNA helicase
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU11820 (yjcD)
   03430 Mismatch repair
    BSU11820 (yjcD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU11820 (yjcD)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BSU11820 (yjcD)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU11820 (yjcD)
   MMR (mismatch excision repair)
    Other MMR factors
     BSU11820 (yjcD)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 Viral_helicase1 AAA_30 AAA_12 AAA_14 ResIII
Other DBs
NCBI-GeneID: 939813
NCBI-ProteinID: NP_389064
Pasteur: BG13157
BSORF: BG13157
UniProt: O31626 A0A6M3Z9J8
LinkDB
Position
complement(1253713..1255866)
AA seq 717 aa
MLRLNIADPPEFIHRQPGDFPACEEACEPKPSKEGKKEDDQESGVIRLPKGKAIAADPSP
AVTEWHRPRSIKPGTPFVPKTIEPDTSLFPSVGLNTDQLKAVTETEGPLLVLAGAGSGKT
RVLTARAAHMIEHLGIPPENMLLVTFTTKAVAEMKERMANQYGLQPAKVRRIVTGTFHSL
FYKILYHSNSAKWNGEHLLKMEWQREQYIKKALYEEGIDEKESPVDQALQQIGFWKNTYV
PNERIPLKDEWEKQVYRLYEHYERQKKEHSQFDFDDMASACYELFIERPDLLEQYQSRFT
YILIDEFQDINPVQYKIMQMLASPEQNLCCVGDDDQSIYAFRGSNPSFILDFQKDYPGAK
TIYLTANYRSTHPIVSSADIVVKKNKNRYAKTLEAARDDIQVPVLFYPYDEEEEATMVVS
DIKEKIQNGASPEDFAVLYRTNSGGRAIYERLHQSSIPYTADRGVQSFYSRRIVRQILAY
LYASQNEDDTEAIKHLLPALFLKQSALNTLKALSITEDCTMIKALAKLPDLKPFQLDKIK
KIVPFFASLRTMKPVEAITFAEGKMGFSEYLKKRGNEGNKLEKGSDDLRDIKVVAKKFKT
IPDFLAHVDHMRAAEKNRTDEHGVQLMTIHRSKGLEFKTVYVLGTVDGSIPHDFSLETAR
KGDEAALEEERRLLYVAMTRAKQHLYLSCPANRRGKTANRSRFLYPLLQKARQPLHH
NT seq 2154 nt   +upstreamnt  +downstreamnt
ttgttacggcttaacatcgccgatccgccagagtttatccatcgccagccaggcgatttt
ccggcatgtgaggaggcgtgcgaaccgaagccctctaaagaggggaaaaaagaagatgat
caggaatctggtgtcattcgtttacccaagggaaaagcgatcgccgctgacccgtcccca
gctgttacagaatggcaccgtcctagaagcattaaaccaggaacaccatttgtgccaaaa
acaatagaacccgatacgagcctttttccgtctgtcggtttaaacacggatcagctgaaa
gctgtcacggaaacagagggcccgctcctcgtgcttgcaggtgcggggagcggaaaaaca
cgggtactgacagcccgtgccgcccacatgatcgaacacttaggcataccgcctgaaaat
atgctgcttgtcacctttacaacaaaagctgtcgctgaaatgaaagagcgtatggcgaac
cagtacggattacagccggcaaaagtcagaagaattgtgacaggaacattccacagtctg
ttttataagatcttgtatcactctaattctgctaaatggaacggtgagcatctgctgaaa
atggagtggcagcgggaacaatatatcaaaaaagcactctatgaagaaggcatcgatgag
aaagaatccccagttgaccaagccctgcagcagatcggtttttggaaaaacacttatgtc
ccaaatgaacgcatccctctaaaagatgagtgggaaaaacaagtttatcgtttatatgaa
cattatgaacgccagaaaaaagaacacagccaatttgattttgatgacatggcttcagcc
tgctatgaattgtttatcgagcggcctgaccttctggaacaatatcaatctcggtttacg
tatatcttaattgatgagtttcaggacattaatccggttcaatacaaaatcatgcaaatg
ctcgccagcccggagcaaaacctgtgctgtgtcggagacgatgaccagtccatctacgcg
tttcgcggaagcaatccgtctttcattcttgattttcaaaaggattatccgggagcgaag
acgatctatttaactgcgaactacaggtctacgcacccgatcgtctctagtgctgatatc
gttgtgaaaaagaacaaaaacagatatgccaaaacgcttgaagcggcccgcgatgacatt
caggtccctgtgctgttttatccttatgatgaagaggaagaagccacaatggtcgtttcc
gatatcaaagaaaaaattcaaaatggagccagtccagaagactttgcggttctttaccgc
acaaacagcggaggccgtgctatatatgaaaggcttcatcaatcgtcaattccgtataca
gctgaccgcggcgtccaatcgttttacagcagacggatcgtccgccagattctcgcctac
ttgtacgccagccaaaatgaggatgacaccgaggcgattaaacacttgcttcccgccttg
tttttaaaacagtccgctttgaatacgctgaaggcgctctcgattacagaggactgtacc
atgatcaaagcgctggccaaattgcctgatctgaagccattccagctggacaaaatcaag
aaaatcgtaccgttttttgcaagcctccgcacaatgaaacccgtagaagccatcaccttt
gcagaaggaaaaatgggcttctccgagtatttaaaaaagcggggcaatgagggcaacaag
ctggaaaaaggctctgatgacctgcgcgacatcaaggttgtcgccaagaagttcaaaacg
attcctgactttcttgcccacgtagaccatatgagggccgctgagaaaaacagaacggat
gaacatggcgttcagctgatgaccattcaccggtcaaaaggccttgaattcaaaacagtc
tacgtgttaggcactgtagatggctcgattccgcacgatttctcattagaaacggcaaga
aaaggagacgaggccgctcttgaggaggaaagacgccttttatatgtagccatgacccgg
gcgaaacagcatttatatttgtcttgccctgctaacaggcgcggcaaaacagccaaccgc
tcaagatttttgtatcccctgctacagaaagcaagacagcccttgcatcattaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU33450
Entry
BSU33450          CDS       T00010                                 
Symbol
helD
Name
(RefSeq) helicase IV
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03420  Nucleotide excision repair
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BSU33450 (helD)
   03430 Mismatch repair
    BSU33450 (helD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU33450 (helD)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     BSU33450 (helD)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     BSU33450 (helD)
   MMR (mismatch excision repair)
    Other MMR factors
     BSU33450 (helD)
SSDB
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C_2 UvrD_C AAA_30 DUF2075 Viral_helicase1 PhoH DEAD AAA_16 ResIII NACHT
Other DBs
NCBI-GeneID: 936037
NCBI-ProteinID: NP_391225
Pasteur: BG14101
BSORF: BG14101
UniProt: O32215 A0A6M4JP70
Structure
LinkDB
Position
complement(3434327..3436651)
AA seq 774 aa
MNQQDKEWKEEQSRIDEVLKELEKKERFLETSAGGLKHDIIGLRKSFWEDVKVNFDDAHE
AIETMASIKQQAELLSDREHNHRRMDQQLKRIHQLKKSPYFGRIDFIENGEEQAERIYIG
LASCLDEKEEHFLIYDWRAPISSLYYNYSPGKAEYEVPGETIEGEMVLKRQFMIKNGTLK
AMFNTDMTIGDEMLQEVLSHHSDTQMKNIVSTIQKEQNQIIRNEKSKILIVQGAAGSGKT
SAALQRVAYLLYRHRGVIDAGQIVLFSPNFLFNSYVSSVLPELGEENMEQATFQEYIEHR
LGRKFKCESPFDQLEYCLTETKGGDFPTRLAGITWKAGLSFQQFINEYVTRLSSEGMIFK
NIIFRGQKLITKEQIQSYFYSLDQNHSIPNRMEQTAKWLLSELNKLEKKERRKDWVVHEA
ELLDKEDYLDVYKKLQERKRFSESTFNDYQREQQLLAAIIVKKAFKPLKQAVRLLAFLDV
TQLYLQLFSGWGGKFQHEKMDAIGELTRSAFTDNKLLYEDAAPFLYMQDLIEGRKKNTKI
KHLFIDEAQDYSPFQMAYMRSIFPAASMTVLGDINQSIYAHTINGDQRMDACFEDEPAEY
VRLKRTYRSTRQIVEFTKAMLQDGADIEPFNRSGEMPLVVKTEGHESLCQKLAQEIGRLK
KKGHETIAVICKTAHQCIQAHAHMSEYTDVRLIHKENQPFQKGVCVIPVYLAKGIEFDAV
LVYDASEEHYHTEHDRRLLYTACTRAMHMLAVFYTGEASPFVTAVPPHLYQIAE
NT seq 2325 nt   +upstreamnt  +downstreamnt
atgaatcagcaggataaggaatggaaggaagagcagtcgagaatagatgaggtgctgaag
gagctcgaaaaaaaagagcggtttctggaaacgtctgcgggcgggttgaagcatgatatc
atcggattaagaaaaagcttttgggaggatgttaaggttaattttgatgatgcccatgaa
gcgattgaaacgatggctagcattaagcagcaggcagagctgctgtctgatcgggaacac
aatcatcggcgcatggatcagcagctcaaacgaattcatcaattgaaaaaatcgccttat
ttcggccggattgattttattgaaaacggcgaggagcaggcagagcgaatttatatcggt
ttagcttcctgtttggatgagaaggaggaacactttctgatctatgactggagggcgccg
atatcaagtttgtactacaattattccccaggaaaagcggagtacgaggtgcccggtgaa
acgatagaaggggaaatggtgctgaaacgccagtttatgatcaaaaacggcactctcaag
gcgatgtttaataccgatatgacgattggcgatgaaatgctgcaagaggtattaagccat
cactctgatacccaaatgaaaaacatcgtgtctacgattcagaaagaacaaaatcagatt
atccgtaatgaaaaaagcaagatcctgatcgtgcagggagcggctggcagcgggaaaaca
tcggctgcgcttcagcgtgtcgcttatttgttatacaggcaccgcggtgtcattgatgcc
ggacaaatcgttttgttttcacccaacttcttatttaacagctatgtctcctctgttttg
ccggagttaggagaagagaatatggagcaggcgacgtttcaggaatatatcgagcatcgt
cttggccgcaagttcaaatgtgaaagcccctttgatcagctcgaatattgcctgaccgaa
acaaagggaggcgattttccaacaaggcttgcaggaatcacatggaaggcgggtttatcc
tttcagcaattcattaatgaatacgtcacacggctttcctctgaagggatgatttttaaa
aatattatattccgcggacaaaagctgatcacaaaggagcaaattcaatcctatttttac
tcattggatcaaaatcactccattccgaatcggatggagcaaaccgcgaagtggctgctg
agtgagcttaacaagcttgagaaaaaggaacggcgaaaggattgggttgttcatgaagct
gagctgcttgacaaagaggactacttggacgtgtacaaaaaactgcaggaaaggaaacgg
ttcagcgagagtacgtttaacgattatcaaagagagcagcagctgcttgccgccatcatt
gtgaaaaaagctttcaaaccgctcaaacaggcagtcaggctccttgcatttcttgatgtt
acacaactttatttgcaattgttttctggctggggaggaaaatttcaacatgagaagatg
gatgcgataggtgagctgacccgttcggcatttacggataataaattgctctatgaggac
gcggcaccgtttctttatatgcaggatctgattgagggcagaaagaaaaatacgaaaatc
aaacatctatttattgacgaagcccaggactattcaccgtttcagatggcttacatgaga
agcatttttccggctgccagcatgacagtgctcggtgatatcaatcagtccatctacgcg
cataccataaacggggatcagcgtatggatgcgtgctttgaggatgagcctgctgagtat
gttcgtttaaagagaacatacagatcaacaaggcagattgtcgagtttaccaaagcgatg
cttcaagatggagcggatattgagccgtttaatagaagcggggaaatgccgctcgttgtc
aaaactgaaggacatgagagcctttgccaaaagctcgcgcaagaaattggccggctcaag
aaaaaagggcacgaaacaatagccgtcatctgcaagactgcgcatcaatgcatacaggcg
cacgcccacatgagtgaatatacagatgttcgcctgattcataaagaaaatcaaccattt
caaaagggtgtttgcgtgattccggtgtatttagcgaagggaattgaatttgacgcagtg
cttgtctatgatgcatctgaagaacactatcatacagagcacgaccgcaggcttttatat
actgcgtgcacccgtgcgatgcacatgctggcggtattttatacaggtgaagccagtccg
tttgtaaccgctgtgccgcctcacttatatcagattgctgaatga

DBGET integrated database retrieval system