KEGG   Bacillus subtilis subsp. subtilis 168: BSU11430
Entry
BSU11430          CDS       T00010                                 
Symbol
oppA
Name
(RefSeq) oligopeptide ABC transporter binding lipoprotein
  KO
K15580  oligopeptide transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU11430 (oppA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11430 (oppA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU11430 (oppA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11430 (oppA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BSU11430 (oppA)
SSDB
Motif
Pfam: SBP_bac_5
Other DBs
NCBI-GeneID: 936398
NCBI-ProteinID: NP_389025
Pasteur: BG10771
UniProt: P24141 A0A6M4JM05
LinkDB
Position
1219849..1221486
AA seq 545 aa
MKKRWSIVTLMLIFTLVLSACGFGGSGSNGEGKKDSKGKTTLNINIKTEPFSLHPGLAND
SVSGGVIRQTFEGLTRINADGEPEEGMASKIETSKDGKTYTFTIRDGVKWSNGDPVTAQD
FEYAWKWALDPNNESQYAYQLYYIKGAEAANTGKGSLDDVAVKAVNDKTLKVELNNPTPY
FTELTAFYTYMPINKKIAEKNKKWNTNAGDDYVSNGPFKMTAWKHSGSITLEKNDQYWDK
DKVKLKKIDMVMINNNNTELKKFQAGELDWAGMPLGQLPTESLPTLKKDGSLHVEPIAGV
YWYKFNTEAKPLDNVNIRKALTYSLDRQSIVKNVTQGEQIPAMAAVPPTMKGFEDNKEGY
FKDNDVKTAKEYLEKGLKEMGLSKASDLPKIKLSYNTDDAHAKIAQAVQEMWKKNLGVDV
ELDNSEWNVYIDKLHSQDYQIGRMGWLGDFNDPINFLELFRDKNGGNNDTGWENPEFKKL
LNQSQTETDKTKRAELLKKAEGIFIDEMPVAPIYFYTDTWVQDENLKGVIMPGTGEVYFR
NAYFK
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgaaaaaacgttggtcgattgtcacgttgatgctcattttcactctcgtgctgagcgcg
tgcggctttggcggcagcggatcaaacggtgaagggaaaaaggacagtaaaggaaagacg
acacttaacattaatattaaaactgagccgttctccttacatccgggattggcaaatgat
tcagtatcaggcggtgttatccgtcagacttttgaaggattgacacgtatcaatgcagat
ggtgagcctgaagaaggcatggcttctaaaattgaaacgagcaaggacggaaagacatat
acatttaccattcgtgatggtgtgaaatggtctaatggagaccctgtaactgcacaagat
tttgaatatgcttggaaatgggcgcttgaccctaataatgaatcacaatacgcttaccag
ctctactacataaaaggtgctgaagcggcgaataccggaaaaggcagcctagacgatgtg
gcagtaaaagctgtgaatgacaaaacgctgaaggttgaattaaataacccgactccatat
ttcactgaattaactgcgttctatacgtatatgccgatcaataagaaaattgcagagaaa
aataaaaagtggaatacaaatgccggagatgattatgtatcaaacgggccgttcaaaatg
acggcatggaaacacagcggctctattactctcgaaaaaaatgaccagtattgggataaa
gacaaagtcaaactgaagaaaatcgatatggttatgatcaacaataacaatacggaacta
aaaaaattccaagctggcgaacttgattgggccggtatgccgctcggacagcttccgaca
gaatccctgccgaccctgaaaaaagacggttctttacatgttgagccgattgcaggagtg
tattggtacaaattcaacactgaagctaagccattagacaacgtcaatatccgtaaagct
ttaacatattcgcttgaccgtcagtcgattgttaaaaacgttacgcaaggagagcaaatc
ccggcaatggctgcagtgccgcctacaatgaagggatttgaggataacaaagaaggatac
ttcaaagacaatgatgtcaaaacagcaaaagaataccttgaaaaaggcctaaaagaaatg
ggcttaagcaaggcatctgatttgccaaaaatcaaattgtcttacaacactgatgacgca
cacgcgaaaatcgctcaagcagtacaagaaatgtggaagaaaaatttaggcgttgatgtt
gagcttgataactcagagtggaatgtctatattgataagctccacagccaagattatcaa
atcggccgtatgggctggctcggcgacttcaatgatcctatcaacttccttgaattgttc
cgcgacaaaaacggaggaaataacgatacaggctgggaaaatccagaattcaaaaagctt
ctgaatcagtcacaaactgaaacagataaaacaaaacgtgcagagctgctgaaaaaagca
gaaggtattttcattgatgaaatgccggttgccccaatctatttctatactgatacttgg
gtacaggatgaaaacctaaaaggtgttatcatgccaggtactggtgaggtttatttcaga
aacgcatattttaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU11440
Entry
BSU11440          CDS       T00010                                 
Symbol
oppB
Name
(RefSeq) oligopeptide transport system permease protein OppB
  KO
K15581  oligopeptide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU11440 (oppB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11440 (oppB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU11440 (oppB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11440 (oppB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BSU11440 (oppB)
SSDB
Motif
Pfam: BPD_transp_1 BPD_transp_1_N DUF2157
Other DBs
NCBI-GeneID: 936397
NCBI-ProteinID: NP_389026
Pasteur: BG10772
UniProt: P24138 A0A6M3ZA17
LinkDB
Position
1221594..1222529
AA seq 311 aa
MLKYIGRRLVYMIITLFVIVTVTFFLMQAAPGGPFSGEKKLPPEIEANLNAHYGLDKPLF
VQYVSYLKSVAMWDFGPSFKYKGQSVNDLISSGFPVSFTLGAEAILLALALGVLFGVIAA
LYHNKWQDYTVAILTIFGISVPSFIMAAVLQYVFSMKLGLFPVAGWDSWAYTFLPSIALA
SMPMAFIARLSRSSMIEVLNSDYIRTAKAKGLSRPAVTVRHAIRNALLPVVTYMGPMAAQ
VLTGSFIIETIFGIPGLGAHFVNSITNRDYTVIMGVTVFFSVILLLCVLIVDVLYGIIDP
RIKLSKAKKGA
NT seq 936 nt   +upstreamnt  +downstreamnt
ttgctaaaatatatcggaagacgcttagtctatatgattatcacactatttgtgattgta
actgtgacattcttcttaatgcaagcagcaccgggcgggccattttcaggtgagaaaaag
cttccgcctgaaattgaagcaaatttaaatgcgcattatggcttggacaagccgctgttt
gtacaatatgtcagttatttgaaatcagttgcaatgtgggatttcggaccgtcatttaaa
tataaaggtcagagtgttaacgacctgatcagttcaggtttccccgtttcatttactctt
ggagcagaagctattctcctcgctttagcgttaggtgtattgtttggggtcattgcagcc
ctttaccataataagtggcaggattataccgtcgcgattttaacgatatttggtatttcg
gttccgagctttatcatggcggctgttctgcaatatgtgttctccatgaagcttgggctg
tttccggtcgcggggtgggattcctgggcatacacctttttgccttccatcgcacttgct
tccatgccgatggcgtttattgccagactttcccgttcaagcatgatcgaagtgttaaac
agtgattatatccgcacagcgaaagcgaaagggctttcccgcccagcggttacagtgcgg
cacgccattcgaaacgcacttttgccggttgttacatatatgggcccgatggccgcacag
gtcttaacggggagcttcattattgaaaccatttttgggattccggggcttggtgcacac
ttcgtcaacagtattacaaaccgtgattatacggtcattatgggtgtaacggtgttcttc
agtgtcatcttgctattgtgtgtattaatcgtagatgtgttatacggcattattgatcca
agaatcaagctttccaaagcaaagaaaggagcctag

KEGG   Bacillus subtilis subsp. subtilis 168: BSU11450
Entry
BSU11450          CDS       T00010                                 
Symbol
oppC
Name
(RefSeq) oligopeptide transport system permease protein OppC
  KO
K15582  oligopeptide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU11450 (oppC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11450 (oppC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU11450 (oppC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11450 (oppC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BSU11450 (oppC)
SSDB
Motif
Pfam: BPD_transp_1 OppC_N DUF3176
Other DBs
NCBI-GeneID: 936396
NCBI-ProteinID: NP_389027
Pasteur: BG10773
UniProt: P24139 A0A6M3Z9U3
LinkDB
Position
1222533..1223450
AA seq 305 aa
MQNIPKNMFEPAAANAGDAEKISKKSLSLWKDAMLRFRSNKLAMVGLIIIVLIILMAIFA
PMFSRYDYSTTNLLNADKPPSKDHWFGTDDLGRDIFVRTWVGARISIFIGVAAAVLDLLI
GVIWGSISGFRGGRTDEIMMRIADILWAVPSLLMVILLMVVLPKGLFTIIIAMTITGWIN
MARIVRGQVLQLKNQEYVLASQTLGAKTSRLLFKHIVPNAMGSILVTMTLTVPTAIFTEA
FLSYLGLGVPAPLASWGTMASDGLPALTYYPWRLFFPAGFICITMFGFNVVGDGLRDALD
PKLRK
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcagaacattccaaaaaacatgtttgaaccagccgcagcgaatgccggcgatgcagaa
aaaataagtaaaaagagcctttccctctggaaagatgcgatgcttcgcttccgcagcaat
aagcttgcaatggtcgggcttatcattatcgtacttattatccttatggcaatttttgcg
ccgatgttctcaaggtatgattattcaactactaatctcttaaatgcggataagccgcct
tcaaaagatcactggttcggaacagatgatcttggacgggacattttcgtccgtacatgg
gtaggggcgcgaatctcaatctttatcggtgttgcagctgctgttctcgatttgctgatc
ggcgtcatttgggggagcatttcaggcttccgcggaggaagaacagatgaaatcatgatg
cgtatcgctgatatcctttgggcagttccttcattattaatggttatcttactgatggtt
gttcttccgaaaggtctatttacgattattattgccatgacgattacaggctggattaat
atggccagaatcgtgcgcggacaagtgctgcagctgaagaatcaggagtatgtgcttgct
tcacagacactgggtgcaaaaacatcccgtcttctatttaaacatatcgtgccaaacgca
atgggttctattttggtcacgatgacactgacagttcctactgcgatttttacagaagcc
tttttaagctatttgggacttggtgttccggctccgctggcaagctggggaacgatggct
tctgacggattgcctgcattgacctattatccgtggcgtttattcttccctgccggattt
atctgcattacaatgtttggttttaacgttgtcggcgacggattaagagacgcattggat
cctaagttacgtaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU11460
Entry
BSU11460          CDS       T00010                                 
Symbol
oppD
Name
(RefSeq) oligopeptide transport ATP-binding protein OppD
  KO
K15583  oligopeptide transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU11460 (oppD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11460 (oppD)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU11460 (oppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11460 (oppD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BSU11460 (oppD)
SSDB
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 AAA_29 TniB ATP-synt_ab ABC_ATPase AAA_16 DUF87
Other DBs
NCBI-GeneID: 939814
NCBI-ProteinID: NP_389028
Pasteur: BG10774
UniProt: P24136 A0A6M3Z9N1
LinkDB
Position
1223455..1224531
AA seq 358 aa
MIRVTRLLEVKDLAISFKTYGGEVQAIRGVNFHLDKGETLAIVGESGSGKSVTSQAIMKL
IPMPPGYFKRGEILFEGKDLVPLSEKEMQNVRGKEIGMIFQDPMTSLNPTMKVGKQITEV
LFKHEKISKEAAKKRAVELLELVGIPMPEKRVNQFPHEFSGGMRQRVVIAMALAANPKLL
IADEPTTALDVTIQAQILELMKDLQKKIDTSIIFITHDLGVVANVADRVAVMYAGQIVET
GTVDEIFYDPRHPYTWGLLASMPTLESSGEEELTAIPGTPPDLTNPPKGDAFALRSSYAM
KIDFEQEPPMFKVSDTHYVKSWLLHPDAPKVEPPEAVKAKMRKLANTFEKPVLVREVE
NT seq 1077 nt   +upstreamnt  +downstreamnt
gtgatacgggtgacacgcctattagaagtaaaagatttagcaatttcatttaaaacatat
ggcggagaggtccaggcgatccgcggagtgaatttccatctggataaaggggagacgctg
gccattgttggagaatcaggttccggaaaaagtgtaacctctcaagcgattatgaagctg
attccaatgcctccgggttatttcaaacgcggtgagatcctgtttgaaggaaaggatctg
gtgccgctgtccgaaaaagaaatgcaaaatgtccggggaaaagagatcggcatgatattc
caagatccgatgacctctttaaatccaacgatgaaggtcggtaaacaaattacggaagtg
ctttttaaacacgaaaagatctcgaaggaagcggctaaaaaacgcgcggttgaactgctg
gaattagtcggtatcccaatgccggaaaagcgggtgaaccaatttccgcatgaattttca
ggcgggatgagacagagggttgtcattgccatggcgcttgcagcgaatccgaaacttctg
atcgccgatgagccgacaactgctcttgatgtaacgattcaagcgcaaattttggaatta
atgaaggatttgcaaaagaaaattgacacgtccatcatctttatcacacacgatcttggt
gttgtggctaacgttgctgaccgggtcgctgtcatgtacgcgggacagattgtagaaact
ggtacggtagacgaaatcttctacgacccgagacatccgtacacttgggggcttcttgca
tccatgccgacactggaaagttcaggagaggaagagctgactgcaattccgggcacgccg
cctgatttgacaaacccgccaaaaggagatgcttttgccctgcggagctcttacgcgatg
aaaatcgattttgaacaggagccgccaatgtttaaggtatccgatactcattatgtaaaa
tcgtggctgcttcatcctgacgcgccaaaggtagagccgcctgaagcggtaaaagcgaaa
atgcgtaaactggcaaacacgtttgaaaaacctgtcttagtgagagaagttgaatga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU11470
Entry
BSU11470          CDS       T00010                                 
Symbol
oppF
Name
(RefSeq) oligopeptide transport ATP-binding protein OppF
  KO
K10823  oligopeptide transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01501  beta-Lactam resistance
bsu02010  ABC transporters
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU11470 (oppF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU11470 (oppF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BSU11470 (oppF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU11470 (oppF)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    BSU11470 (oppF)
SSDB
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_22 ATP-synt_ab G-alpha AIG1 AAA_13 AAA_21 AAA_16 AAA RsgA_GTPase
Other DBs
NCBI-GeneID: 936410
NCBI-ProteinID: NP_389029
Pasteur: BG10775
UniProt: P24137 A0A6M4JH02
LinkDB
Position
1224533..1225450
AA seq 305 aa
MTEKLLEIKHLKQHFVTPRGTVKAVDDLSFDIYKGETLGLVGESGCGKSTTGRSIIRLYE
ATDGEVLFNGENVHGRKSRKKLLEFNRKMQMIFQDPYASLNPRMTVADIIAEGLDIHKLA
KTKKERMQRVHELLETVGLNKEHANRYPHEFSGGQRQRIGIARALAVDPEFIIADEPISA
LDVSIQAQVVNLMKELQKEKGLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPADELYE
NPLHPYTKSLLSAIPLPDPDYERNRVRQKYDPSVHQLKDGETMEFREVKPGHFVMCTEAE
FKAFS
NT seq 918 nt   +upstreamnt  +downstreamnt
ttgactgaaaaactattagaaatcaaacatttaaaacagcactttgtcacgccgagggga
acggttaaggctgtagatgatttatcatttgatatctataaaggtgaaacattagggctg
gttggtgaatctggctgcggtaaatcgacaacaggccgaagcattatcaggctgtacgaa
gcaaccgatggtgaggtgctgttcaacggcgaaaatgtgcacgggagaaaatcgcggaaa
aagctgctggaattcaaccgcaaaatgcagatgattttccaagacccctatgcatccctg
aatccgagaatgacagttgctgatattattgctgaaggccttgatattcataagctggca
aaaacgaaaaaagagcggatgcagcgagttcatgaactattggaaacagtgggattgaac
aaggaacacgcgaaccgctatcctcatgaattttccggcggccagcgccaaagaatcggg
attgccagagcgcttgctgttgatccggaattcattatcgcggatgagccgatttccgct
ttggatgtatccattcaagcgcaggtcgtgaatttaatgaaagaactgcaaaaagaaaaa
gggctcacatacctgtttattgcccacgatttatcgatggtcaaatacatcagtgaccgc
attggcgtcatgtatttcgggaaactggttgagcttgcgccggcagatgagctttatgaa
aatccgcttcacccatatacaaaatcattgctttctgcgattccgcttcctgatccggac
tatgagagaaatcgcgttcgccagaaatatgatccgtctgtccatcaattaaaggatggg
gaaacgatggaattccgtgaagtcaaaccgggacattttgtgatgtgcacggaagccgaa
tttaaagctttttcatga

DBGET integrated database retrieval system