KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_10825
Entry
Q433_10825        CDS       T03469                                 
Symbol
ppsCb
Name
(GenBank) ppsCb
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    Q433_10825 (ppsCb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsus01008]
    Q433_10825 (ppsCb)
Polyketide biosynthesis proteins [BR:bsus01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    Q433_10825 (ppsCb)
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AID00465
LinkDB
Position
complement(1968561..1971158)
AA seq 865 aa
MTSSIGFDVGSFEIFGPLLNGAALHLSDQQTFLDSHQLKRYIEHQGITTIWLTSSLFNHL
TEQNEQTFSQLKHLIIGGEALSPSHVNRIRNVCPEVSIWNGYGPTENTTFSTCLHIQKTY
ELSIPIGRPVGNSTAYILNQWGVLQPVGAVGELCVGGDGVARGYLGRPDLTKEKFVPHPF
APGDRLYRTGDLARWLPDGTIEYVGRIDDQVKVRGYRVELGEIESALRQIDGVKEAAVLA
RTAQTGSKELFGYISVKAGTNAEQVRSLLARSLPNYMIPAYIIEMETLPLTSNGKLNRKA
LPEPNFTSQTYAPPRNDLEDQLVLIWQEVLGIQRIGIEDSFFELGGDSIKALQVSARLGR
YGLSLQVSDLFRHPKIKDLSPFIRKSERIIEQGPVQGDVPWTPVQQWFFSQDIEERHHFN
QSVMLFHSGHLSENALRPALKKLAEHHDALRMVYRNDDRRWIQINQGIHESQLYSLRTFD
LSQSESGWETQIKQEVADLQQSINLQEGPLLHAALFKTLTGDYLFLAIHHLVVDGVSWRI
LLEDLSAGYQQAAAGQTIQLPPKTDSYQEYARRIQEYAQSSKLIREEAYWRTVEEQQDAE
LPYEIPHHVNIDFSKRDSLSFSLTEADTAVLLQNINHAYGTDTQDILLTAASLAICEWTG
GSMLRIAMEGHGREHILPELDISRTVGWFTSMYPALISFENHRYELGTALKTVKDTLGRI
PNKGVGYGMLKYLTHPENKSITFSKTPEISFNYLGQFNDIERQDTFRPSSLGSGKDITHT
WKREQIIEMSAMAADKKLHFNLSYPPARFHRNTMEQLINRIEHFLLDIMKHCAGQQKTEK
TLSDFSSQSLTAEDLDSISSLVEEL
NT seq 2598 nt   +upstreamnt  +downstreamnt
atgacatcatcaatcggtttcgacgttgggtcatttgaaattttcggaccgctgctaaat
ggtgccgctttgcatctgtccgatcaacaaacatttctcgattcccatcagcttaagagg
tacatagaacatcaaggaatcacaacgatttggctgacatcttctctattcaatcatttg
acagaacaaaatgaacaaacattttcacagctgaaacatttgattataggcggagaagct
ttgtcgccgagccacgtcaatcgaatcagaaatgtctgccctgaagtatctatatggaat
ggatatggccctaccgaaaatacaactttttcgacatgccttcacattcaaaaaacatat
gaactttccattccgatcgggcggccggttggtaattccaccgcttatatcttaaatcaa
tggggagtgctgcagccggtcggagctgtcggtgaactttgtgtcggcggagatggcgtc
gccagaggatatttgggccgtcctgatttaacgaaagagaaatttgtcccacatccattt
gcacctggcgatcgactgtatcgcacaggtgatctggcgcgctggcttcctgacggcaca
attgagtacgttggccgtattgatgatcaagtaaaagtcagaggctatcgtgtggagctg
ggtgagatcgaatcagcacttcgtcaaatagacggggtcaaagaagccgcagtgttagca
cgtacagcccagaccgggagcaaagagctgtttggctatatcagcgtaaaagcaggcacg
aatgctgaacaagtgcgttcacttctcgcgcgttcgctgccaaactatatgatcccggcg
tacattattgaaatggagactcttccgctcacatcaaacggcaaattgaaccgaaaagca
cttcctgaaccaaatttcacatcacaaacgtacgctccgcctcgaaatgaccttgaagac
caacttgtgttgatctggcaggaggttctcggcatccagaggatcggaatagaggattcg
ttttttgaattgggcggagattcaatcaaagcccttcaagtttctgcacgccttggacgc
tatgggctaagcttgcaggtaagtgatttattccgtcatccaaagataaaggacttatca
ccatttatccgtaagtcagagagaatcatagagcaaggacccgttcagggagacgttcct
tggacgcctgttcagcaatggtttttttcacaagatattgaagaaagacaccatttcaat
cagtctgtcatgctattccattctggacatttgtctgaaaacgcccttagaccagccttg
aaaaaactggcggagcatcatgatgcgcttcggatggtttatcgcaacgatgataggcga
tggattcaaatcaaccaaggcattcatgagtcacagctatacagcttaagaacctttgat
ctttcacagtcagaaagcggctgggagacgcaaatcaaacaagaagttgcagatcttcag
caaagcatcaatttgcaggaaggaccattgttgcacgccgctttgtttaaaacactgacc
ggagattacttgttccttgcgatccatcaccttgtcgttgatggtgtctcatggcggatt
ttgcttgaggatttgtcagccggatatcaacaagctgctgcaggccagacgatccagctt
ccgcctaaaacggattcctatcaggaatacgcaagacgcatacaggaatatgcccaaagc
agtaagctgattcgcgaagaggcgtattggcgaactgtagaagaacagcaagacgcagaa
ctgccctatgaaataccgcatcatgtgaacatcgacttcagcaaaagggactcattaagc
ttttcactgactgaagcagacaccgccgtcttgctgcaaaacatcaatcacgcctatggc
acagatacacaagatattctgttaaccgcagcatccttggcgatttgtgaatggacagga
ggaagtatgctccgtatcgctatggaaggacacgggagagaacatattctgccagagtta
gatatcagcaggacggtcggctggtttacatccatgtatccggccctcataagctttgaa
aatcataggtatgagctcggaaccgcattaaaaaccgttaaagatacactgggccggata
ccaaacaaaggggtaggttacggtatgctgaaataccttacacaccctgaaaataaaagc
attacgttttcaaaaacacctgaaatcagctttaactatttgggccagttcaacgacatc
gaaagacaggacaccttccgcccatcaagccttgggagcggaaaggatatcactcataca
tggaagcgtgagcaaatcatcgagatgagcgcaatggcagcagacaaaaagctccatttc
aatcttagttatccgccagcccgctttcacagaaacacaatggagcagcttattaacagg
attgaacactttttgctggacattatgaaacactgcgccggtcaacagaaaacagaaaag
acactgagcgatttcagcagtcaatcattaacggctgaggacttggacagcatatccagc
ttggtggaagaattgtag

DBGET integrated database retrieval system