KEGG   Bacillus subtilis subsp. subtilis OH 131.1: Q433_16375
Entry
Q433_16375        CDS       T03469                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bsus  Bacillus subtilis subsp. subtilis OH 131.1
Pathway
bsus00780  Biotin metabolism
bsus01100  Metabolic pathways
bsus01240  Biosynthesis of cofactors
Module
bsus_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bsus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Q433_16375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bsus00199]
    Q433_16375
Enzymes [BR:bsus01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     Q433_16375
Cytochrome P450 [BR:bsus00199]
 Cytochrome P450, bacteria type
  CYP107 family
   Q433_16375
SSDB
Motif
Pfam: p450 Cas_Cas5d
Other DBs
NCBI-ProteinID: AIC99329
LinkDB
Position
complement(2902197..2903384)
AA seq 395 aa
MTIASSTASYEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVR
TPLPESSTKYQDLSHVQNQMMLFQNRPDHRRLRTLASGAFTPRTTESYQPYIIETVHHLL
DQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASLIQTIDFTRSRKALTE
GNIMAVQAMAYFKELIQKRKRHPQQDMISMLLKGREKDKLTEEEAASTCILLAIAGHETT
VNLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECLRYESPTQMTARVASEDIDICGVTI
RQGEQVYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVCLGSSLARLEAQIAIN
TLLQRMPSLKLADFEWRYRPLFGFRALEELPVTFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
gtgacaattgcatcgtcaactgcatcttatgagtttttgaaaaacccatattctttttac
gacacattgcgagctgttcatcctatctataaagggagtttcttaaaatatccgggctgg
tatgtcacaggatatgaagaaacggctgctattttgaaagatgcgagattcaaagtccgc
accccgctgcctgagagctcaaccaaatatcaggacctttcacatgtgcaaaatcaaatg
atgctgtttcagaaccggcctgatcatagacgattgcggacgcttgccagcggagcgttt
acgccgagaacgacagagagttatcagccgtatatcattgaaactgtccatcatttgctt
gatcaagtgcaaggtaaaaaaaagatggaggtcatttcggactttgcttttcctttagca
agttttgtcatagctaacattataggtgtaccggaggaagatagggagcaattaaaggag
tgggctgcgagtctcattcaaacgattgattttacccgctcaagaaaggcattaacagag
ggcaatattatggctgtgcaggctatggcatatttcaaagagctgattcaaaagagaaaa
cgccaccctcaacaggatatgatcagcatgctcttgaaggggagagaaaaggataagctg
acggaagaggaggcggcatctacgtgcatattgctggcgatcgccggacatgagacaacg
gtcaatctcatcagcaattcagtcctttgtctgctgcagcatccagaacagcttttgaaa
ctgagagaaaatccagatcttattggtaccgcagtcgaggaatgtttacgctatgaaagc
cccacgcaaatgacagccagagttgcgtcagaggatattgacatctgcggggtgacgatc
cgtcaaggagaacaagtctatcttttgttaggagcggctaatcgagaccctagcatattc
acgaaccccgatgtcttcgatattacgagaagtcctaatccgcatctttcattcgggcat
ggccatcatgtttgcttagggtcctcgctggcacgattagaagcgcaaattgcgattaac
actcttctgcagcgaatgcccagccttaagctcgcggattttgaatggcggtatcggccg
ctttttggatttcgggcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system