KEGG   Bacillus subtilis XF-1: C663_1157
Entry
C663_1157         CDS       T02459                                 
Symbol
med
Name
(GenBank) positive regulator of comK
  KO
K05519  transcriptional activator of comK gene
Organism
bsx  Bacillus subtilis XF-1
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsx03000]
    C663_1157 (med)
Transcription factors [BR:bsx03000]
 Prokaryotic type
  Other transcription factors
   Others
    C663_1157 (med)
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_2
Other DBs
NCBI-ProteinID: AGE62984
UniProt: M4KX71
LinkDB
Position
1210605..1211582
AA seq 325 aa
MSKGVEHDLITRLVMIFSVLLLLSGCGQTPFKGKIEKVGMLFPDTINDLVWGTKGYKGLL
NIQSKYNVDVYYKEGVKTEEDIINAIEDFHKRGVNLLYGHGSEYAEVFNLVGEDYPDMEF
VISNAKAKADNVTSVHFSGEAMGFFGGMTAAHMSKTNQVGVIASFTWQPEVDGFIKGAKY
ENPDIEVNTKYTDHWDDDTTAVKLYQKMKNEGADVVYPAGDGYNVPVIQQIKKDGLYAIG
YVTDQSDLGENTVLTSTVQNVDKAYEIIAEQFNKGTLEGGDHYYDLNTGVVEMGTFSPLV
DKDFQQRIAKLIKTYNKTGELPKNE
NT seq 978 nt   +upstreamnt  +downstreamnt
ttgtcaaaaggagttgaacatgacttgatcacaaggcttgtcatgatcttttctgtcctc
cttttattgagtggatgtggacaaactccgttcaaaggaaaaattgagaaggtcggcatg
ctctttcctgatacgattaatgacctcgtatggggcacaaaagggtataaaggattactg
aatatacaatccaaatacaatgtggacgtctattataaagaaggcgttaaaacagaagaa
gatatcataaatgcgattgaggattttcataagaggggcgtcaatctgctctacggccat
gggagtgaatatgctgaggtgtttaacctggtcggcgaagattatccagatatggaattc
gtcatttccaatgcgaaagcgaaagctgataatgtaacgagtgtccattttagcggggaa
gcaatgggcttttttggaggaatgactgctgcccatatgtcgaaaacgaatcaggtcggt
gtaattgcctcctttacgtggcagcctgaggttgacggttttatcaaaggggccaagtat
gaaaatccggatatagaggtaaatacgaaatatacggatcattgggatgatgatacaaca
gcagtaaagctttatcagaaaatgaagaacgaaggcgcggatgttgtgtatcccgccgga
gacgggtataatgttcctgttattcagcaaatcaaaaaagacggtctttatgccattggc
tacgtcacagatcaatcggatctgggcgagaataccgtattaaccagcacggtgcaaaat
gtggacaaggcctatgaaatcattgctgaacaatttaataaaggcacccttgagggcggc
gatcattactacgacctgaatacgggagtcgttgagatgggaacattcagcccgctcgtc
gacaaagactttcagcaaagaatcgccaagctgatcaaaacatacaacaaaacaggcgag
ctgccaaaaaacgagtaa

DBGET integrated database retrieval system