KEGG   Bacillus subtilis XF-1: C663_1890
Entry
C663_1890         CDS       T02459                                 
Symbol
ppsC
Name
(GenBank) plipastatin synthetase
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bsx  Bacillus subtilis XF-1
Pathway
bsx01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bsx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    C663_1890 (ppsC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsx01008]
    C663_1890 (ppsC)
Polyketide biosynthesis proteins [BR:bsx01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    C663_1890 (ppsC)
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AGE63676
UniProt: M4KVQ1
LinkDB
Position
complement(1982073..1985591)
AA seq 1172 aa
MSRNPLFDVMFVLQNMDQESLELDELCLKPAANNGHQTSKFDLTLYAQEQSHGLLTFQME
FSTDLYKKKTIEKWLQYFINMLLSIIKDNKAALGTINILNEDETHYLIHELNRTKIDYPR
NETISRLFEMQAEQTPNAVAIVSDTQVFTYEDLNSWANQIASVLQIKGVGPDSVVALLTG
RTPELIAGMLGILKAGGAYLPIASDLPVERIAYMLSDSGAALLLQSEKTEKQLLDIECEQ
IIIEDIQKQGETKNVDSSAGSHSLAYIIYTSGSTGKPKGVMIEQRSVIRLVKNSNYITFT
PEDRLLMTSSIGFDVGSFEIFGPLLNGAALHLSDQQTFLDSHQLKRYIEHQGITTIWLTS
SLFNHLTEQNEQTFSQLKHLIIGGEALSPSHVNRIRNVCPEVSIWNGYGPTENTTFSTCL
HIQKTYELSIPIGRPVGNSTAYILNQWGVLQPVGAVGELCVGGDGVARGYLGRPDLTKEK
FVPHPFAPGDRLYRTGDLARWLPDGTIEYVGRIDDQVKVRGYRVELGEIESALRQIDGVK
EAAVLARTAQTGSKELFGYISVKAGTNAEQVRSLLARSLPNYMIPAYIIEMETLPLTSNG
KLNRKALPEPNFTSKQTYAPPRNDLEDQLVLIWQEVLGIQRIGIEDSFFELGGDSIKALQ
VSARLGRYGLSLQVSDLFRHPKIKDLSPFIRKSERIIEQGPVQGDVPWTPVQQWFFSQDI
EERHHFNQSVMLFHSGRLSENAIRPVLKKLAEHHDALRMVYRKDDRRWIQINQGIHESQL
YSLRISDLSQSESGWETKIKQEVADLQQSINLQEGPLLHAALFKTLTGDYLFLAIHHLVV
DGVSWRILLEDLSAGYQQAAAGQTIQLPPKTDSYQEYARRIQEYAQSSKLIREEAYWRSV
EEQQAAELPYEIPHHVNIDFSKRDSLSFSLTEADTAVLLQNVNHAYGTDTQDILLTAASL
AICEWTGGSKLRIAMEGHGREHILPELDISRTVGWFTSMYPALISFEHHRDELGTSVKTV
KDTLGRIPNKGVGYGMLKYLTHPENKSITFSKTPEISFNYLGQFNDIERQDTFRPSSLGS
GKDITHTWKREQIIEMSAMAADKKLHFNLSYPPARFHRNTMEQLINRIEHFLLDIMKHCA
GQQKAEKTLSDFSSQSLTAEDLDSISSLVEEL
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgagccggaatccgctgtttgacgtaatgtttgttcttcaaaacatggatcaggaatcg
ttggagctggatgaactttgtctcaaacctgcagcaaacaatgggcatcaaacgtccaaa
tttgatttaaccctatatgcccaggaacagtcccacggtttgctgacgttccaaatggag
tttagtactgacttatataagaaaaaaacgatagaaaagtggcttcaatacttcatcaat
atgttactctccatcatcaaagacaacaaagccgctctcggaacaataaatatcctgaat
gaggatgagacccattaccttatccacgagctcaatcgtacaaaaatagattatccaaga
aatgaaaccatcagcagactctttgaaatgcaggctgaacaaacacctaatgctgtagca
attgtcagcgacacccaagtattcacttacgaggacctgaacagctgggcaaatcaaatt
gcctcagttctacagattaagggcgtagggcctgatagtgttgtagccttgttgacaggc
agaacaccagaactcattgcaggaatgctgggcattctgaaagccgggggagcctatctg
cctattgcttctgatctgcctgttgaacgaatagcttatatgctgtcagacagcggggcg
gctttactccttcaatctgaaaaaacagaaaaacaactattagacattgaatgtgaacaa
atcataatcgaagatattcaaaagcaaggagaaacgaagaacgttgattcttcagcaggg
tcacattcacttgcatatatcatttatacctctggatcaaccggtaaaccaaagggtgtc
atgattgagcagcgaagtgtaattcgtcttgttaaaaacagcaattatattacatttaca
cctgaagaccgccttctgatgacatcttcaatcggtttcgacgttgggtcatttgaaatt
ttcggaccgctgctaaatggtgccgctttgcatctgtccgatcaacaaacatttctcgat
tcccatcagcttaagaggtacatagaacatcaaggaatcacaacgatttggctgacatct
tctctattcaatcatttgacagagcaaaatgaacaaacattttcacagctgaaacatttg
attataggcggagaagctttgtcgccgagccacgtcaatcgaatcagaaatgtctgccct
gaagtatctatatggaatggatatggccctaccgaaaatacaactttttcgacatgcctt
cacattcaaaaaacatatgaactttccattccgatcgggcggccggttggtaattccacc
gcttatatcttaaatcaatggggagtgctgcagccggtcggagctgtcggtgaactttgt
gtcggcggagatggcgtcgccagaggatatttgggccgtcctgatttaacgaaagagaaa
tttgtcccacatccatttgcacctggcgatcgactgtatcgcacaggtgatctggcgcgc
tggcttcctgatggcacaattgagtacgttggccgtattgatgatcaagtaaaagtcaga
ggctatcgggtggagctgggtgaaatcgaatcagcacttcgtcaaatagacggggtcaaa
gaagccgcagtgttagcacgtacagcccagaccgggagcaaagagctgtttggctatatc
agcgtaaaagcaggcacgaatgctgaacaagtgcgttcacttctcgcgcgttcgctgcca
aactatatgatcccggcgtacattattgaaatggagactcttccgctcacatcaaacggc
aaattgaaccgaaaagcacttcctgaaccaaatttcacatctaaacaaacgtacgctcca
cctcgaaatgaccttgaagaccaacttgtgttgatctggcaggaggttctcggcatccag
aggatcggaatagaggattcgttttttgaattgggcggagattcaatcaaagcccttcaa
gtttctgcacgccttgggcgctatggactaagcttgcaggtaagtgatttattccgtcat
ccaaagataaaggacttatcaccatttatccgtaagtcagagagaatcatagagcaagga
cccgttcagggagacgttccttggacgcctgttcagcaatggtttttttcacaagatatt
gaagaaagacaccatttcaatcagtctgtcatgctattccattctggacgtttgtctgaa
aacgccattagaccagtcttgaaaaaactggcggagcatcatgatgcgcttcggatggtt
tatcgcaaagatgacaggcgatggattcaaatcaaccaaggcattcatgagtcacagcta
tacagcttaagaatctctgatctttcacagtcagaaagcggctgggagacgaaaatcaaa
caagaagttgcagatcttcagcaaagcatcaatttgcaggaaggaccattgttgcacgcc
gctttgtttaaaacactgaccggagattacttgttccttgcgatccatcaccttgtcgtt
gatggtgtctcatggcggattttgctggaggatttgtcagccggatatcaacaagctgct
gcaggccagacgatccagcttccgcctaaaacggattcctaccaggaatacgcaagacgc
atacaggaatatgcccaaagcagtaagctgattcgcgaagaggcgtattggcgaagtgta
gaagaacagcaagccgcagaactgccctatgaaataccgcatcatgtgaacatcgacttc
agcaaaagggactcattaagcttttcactgactgaagcagacaccgccgtcttgctgcaa
aacgtcaatcacgcctatggcacagatacacaagatattctgttaaccgcagcatccttg
gcgatttgtgaatggacaggaggaagcaagctccgtatcgctatggaaggacacgggaga
gaacacattctgccagagttagatatcagcaggacggtcggctggtttacatccatgtac
ccggccctcataagctttgaacatcatagggatgagctcggaacctcagtaaaaaccgtt
aaagatacactgggccggataccaaacaaaggggtaggttacggtatgctgaaatacctt
acacaccctgaaaataaaagcattacgttttcaaaaacacctgaaatcagctttaactat
ttgggccagttcaacgacatcgaaagacaggacaccttccgcccatcaagccttgggagc
ggaaaggatatcactcatacatggaagcgtgagcaaatcatcgagatgagtgcaatggca
gcagacaaaaagctccatttcaatcttagttatccgccagcccgctttcatagaaacaca
atggagcagcttattaacaggattgaacactttttgctggacattatgaaacactgcgcc
ggtcaacagaaagctgaaaagacactgagcgatttcagcagtcaatcattaacggcagag
gatctggacagcatatccagcttggtggaagaattgtag

DBGET integrated database retrieval system