KEGG   Bos taurus (cow): 101904063
Entry
101904063         CDS       T01008                                 
Symbol
ITGAX
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-X
  KO
K06462  integrin alpha X
Organism
bta  Bos taurus (cow)
Pathway
bta04610  Complement and coagulation cascades
bta04810  Regulation of actin cytoskeleton
bta05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101904063 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101904063 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101904063 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:bta04515]
    101904063 (ITGAX)
   04090 CD molecules [BR:bta04090]
    101904063 (ITGAX)
Cell adhesion molecules [BR:bta04515]
 Integrins
  Integrin alpha subunits
   101904063 (ITGAX)
CD molecules [BR:bta04090]
 Proteins
  101904063 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha FG-GAP_3 AA_permease
Other DBs
NCBI-GeneID: 101904063
NCBI-ProteinID: XP_024841064
LinkDB
Position
25:27398392..27419163
AA seq 1167 aa
MPTSDLLVMTRTRVFLFLLMAPVSSLCFNLDTEQPTTFRVDSPGFGHSVVQYAQWLVVGA
PREVKAANQTGGLYSCDYGTGKCEAIPLQVPPEAVNMSLGLSMAATTNPFQLLACGPTVH
HACRENMHLTGTCFLLASPFRQVKRIPAALQECPRQDQDIAFLIDGSGSIFSSDFNKMLN
FVKAVMSQFQRPNSQFSLVQFSSTFKVHFAFKDFATSSDPLSLLNSVQQLQGWTFTASAI
RFVTXIXLLSAANGARKDASKILIVITDGEKTENLGYKDVIPRAEAAGIIRYAIGVGSAF
RYKKSLKELIDIASTPSEEHVFQVENFDALRDIQKQLKEKIFAIEGTQTISSSSFELEMS
QEGFSAVFMPDGPVLGAVGSFSWSGGAFLYPPNKNPTFINMSQEHVDMRDSYLGYSTELA
LWRGAQSLILGAPRHQHTGKVVLFTQVSRQWRPQAEVTGTQIGSYFGASLCSVDVNGDSS
SDLILIGAPHFYEQTQGGQVSVCPFPRGRAKWQCDAVLRGEPGHPWGRFGAALTALGDVN
GDRLADVAIGAPGEQENQGAVYLFHGTSELGISPSHSQRVTGAQLSPSLQYFGQSLSGGQ
DLTQDGLADVAVGAQGHALLLRTRPVLRMWANIHITPAEIARSVYECQQLVTFPHDLGKA
IVCLQVSQSSKNQLVNLQSIVTFDLTLDPGRLSSRAIFQETGTRNLTRVRELGLKQHCEA
VRLLLPDCVEDSVTPIILRLNFSLVGKPISSLRNLQPMLAVDAQRYFTTSLPFEKNCGAD
HVCQDDLSISFGVSDLKTLIVGSNLELNLKVRVWNDGEDSYGTAVTFFYPPGLSYRRVTG
GQSHLQSRSLRLTCDSAPAGTQGTRSTRCSVNHLIFREGAQVTFTVTFHVSPTATLGDKL
LLAANVSSENNSPKTSKTAFQLELPVKYAVYTVISSHEQSTKYLNFSASQEEGSREAQHR
YQVNNLGQRELPVSIDISVPMELNQVPVWKDIEVLNPQNPSIQCSSERTAPTESDFLTHF
KKKPVLDCSIAVCLRFRCDIPSFGIQEELDFILKGNLSFRWVSQTQQKKVLVVSVAEITF
NRLVYSQLPGQETFLRAQTELVLEKYEVYNPIPLIVGSSLGGLLLLALITALLYKVGFFK
RQYKEMMEGANQQTVPENETGNPQAAQ
NT seq 3504 nt   +upstreamnt  +downstreamnt
atgcccacatctgaccttcttgtcatgaccaggacccgggtttttctcttcctgttgatg
gccccggtgtcctctctctgcttcaacttggacacagagcaaccgacaaccttccgtgtg
gacagccctgggtttggacacagtgtggtccagtatgcccaatggctggtggttggagcc
ccccgggaggtaaaggctgccaatcaaacaggcggcctctactcgtgtgactacggcacg
gggaagtgtgaggccatccccctgcaggtgcctccagaggctgtgaacatgtccctgggc
ctgtccatggcagccaccaccaacccctttcaactgctggcctgtggccccaccgtgcac
cacgcatgccgggagaacatgcacttgaccgggacctgcttcctgctggcctccccgttt
cggcaggtcaagaggatcccggctgccctgcaggagtgcccaaggcaggatcaggacatc
gcctttctgatcgacggctcaggcagcatcttttccagcgattttaacaaaatgttgaac
ttcgtgaaggccgtgatgagccagttccagcgtcccaactcccagttctccctggtacag
ttctccagcacgttcaaggtgcacttcgctttcaaagacttcgctaccagctcagaccca
ctaagcctcctgaattccgtccagcagctgcaagggtggacgttcacggcctcagccatc
cgatttgtcacgtgaatctagctgctcagtgccgccaacggggcccgaaaagatgcctcc
aaaatcctcatcgtcatcactgatggggagaaaacagaaaacctgggttacaaggatgtc
attccccgggctgaggccgccggcatcatccgatatgcaattggggtgggatcagcattt
cgatacaaaaagtccttgaaagaattaatcgacattgcctccacaccctctgaagagcat
gtatttcaagtggagaactttgatgctttgcgagacattcagaaacaactgaaagagaag
atttttgccattgagggtacacagaccataagcagtagttccttcgaactggagatgtct
caggagggcttcagtgctgtgttcatgcctgatggaccagttttgggggctgtggggagc
ttcagctggtctggaggtgccttcctgtaccccccaaataagaaccccaccttcatcaac
atgtcccaggagcacgtggacatgagggactcgtatctgggttactccacagagctggcc
ctttggaggggggcacagagcctgatcctgggggcgccccgccatcagcacaccgggaag
gtggtcctcttcacccaggtgtccaggcaatggaggccacaggctgaagtcacagggacc
cagatcggctcctacttcggggcctccctctgctctgtggatgtgaatggagatagtagc
tctgacctgatcctcatcggggcccctcatttctacgagcagacccaggggggccaggtg
tccgtgtgcccctttccccgggggagagctaagtggcagtgtgatgctgtcctgcgaggg
gagccgggccacccctggggccgctttggggcagccctgacagcgctgggggatgtgaat
ggggacaggctggcagatgtggccattggggccccgggagagcaggagaaccagggtgct
gtctacctgttccatggaacctcagaactgggcatcagcccctcccacagccagcgggtc
acaggcgcccagctctcccccagcctccagtatttcgggcagtcgctgagcgggggtcag
gacctcacccaggatggactggcagacgtggctgtgggggcccaggggcacgcactgctg
ctcaggaccagacctgtgctcaggatgtgggcgaacattcacatcacacctgcagagatc
gctaggtctgtgtatgagtgtcagcagctggtgacctttccgcatgatctgggcaaggcc
attgtctgcctccaagtttcccaaagttccaagaaccagctggttaacctccaaagcatt
gtgacctttgacctaacccttgaccccggccgcctgagttctcgtgccatcttccaagaa
acggggactcggaatctgacccgtgttcgagagctggggctgaagcagcactgtgaggct
gtgaggttgctccttccggactgtgtggaggactcggtgacccccatcatcttgcgtctc
aacttctccctggtgggcaagcccatctctagcctaagaaacctccagcctatgttggca
gtggacgcccagagatacttcacaacctctctcccctttgagaagaactgtggcgcagat
cacgtctgccaggatgacctcagcatctcctttggggtctcagacttgaagaccctgatc
gtgggtagtaacctggagctaaacctgaaagtgagagtgtggaatgatggcgaggactcc
tatggaaccgcagtcaccttcttctaccctccagggttgtcttaccgacgtgtgactggg
ggccagagccatctgcagtcgcgttccctgcgcctgacctgtgacagcgcccccgccggg
acccagggcaccagaagcacccgctgtagcgtcaaccacctcatcttccgtgagggcgcc
caggtcaccttcacggtcacctttcacgtctcccccacggccaccctgggagacaagctg
cttcttgccgccaatgtgagcagtgagaataacagccccaagacaagcaagaccgccttc
cagctggagctccccgtgaagtatgccgtctacaccgtgatcagcagccacgaacaatcc
accaagtacctcaacttctcggcctcacaggaggagggcagcagggaggcccagcacaga
taccaggtgaacaacctggggcagagggagctgcctgtcagcatcgacatctcagtgcct
atggagctgaaccaggtgcccgtgtggaaggacatagaggtcctcaacccccagaacccc
tccattcagtgctcttcagagagaacagcgcccacagagtctgatttcctgacccacttt
aagaagaagcctgtcctggactgctccatcgctgtctgcctaaggttccgctgtgacatc
ccctcctttggcatccaggaggaacttgacttcatcctgaagggcaacctcagcttccgc
tgggtcagccagacacagcagaagaaggtgctggtcgtgagcgtggctgaaatcaccttc
aacagactcgtgtattctcagcttccaggacaggagacatttttgagagctcagacggag
ctggtgctggagaagtatgaggtctacaaccccatccccctcattgtgggcagctctctg
ggaggactgctgctcctggccctcatcacagccctactgtacaaggttggtttcttcaaa
cgtcagtacaaggaaatgatggaaggagcaaaccaacagactgtcccagaaaacgagaca
ggaaacccccaagctgcccaataa

DBGET integrated database retrieval system