Bos taurus (cow): 281111 Help Entry 281111            CDS       T01008                                  Symbol CYBA Name (RefSeq) cytochrome b-245 light chain   KO K08009   cytochrome b-245, alpha polypeptide Organism bta  Bos taurus (cow) Pathway bta04145   Phagosome bta04380   Osteoclast differentiation bta04613   Neutrophil extracellular trap formation bta04621   NOD-like receptor signaling pathway bta04670   Leukocyte transendothelial migration bta05020   Prion disease bta05140   Leishmaniasis bta05208   Chemical carcinogenesis - reactive oxygen species bta05415   Diabetic cardiomyopathy bta05417   Lipid and atherosclerosis bta05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     281111 (CYBA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     281111 (CYBA)    04621 NOD-like receptor signaling pathway     281111 (CYBA)    04670 Leukocyte transendothelial migration     281111 (CYBA)   09158 Development and regeneration    04380 Osteoclast differentiation     281111 (CYBA)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     281111 (CYBA)   09174 Infectious disease: parasitic    05140 Leishmaniasis     281111 (CYBA)   09164 Neurodegenerative disease    05020 Prion disease     281111 (CYBA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     281111 (CYBA)    05418 Fluid shear stress and atherosclerosis     281111 (CYBA)    05415 Diabetic cardiomyopathy     281111 (CYBA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     281111 (CYBA) Membrane trafficking [BR:bta04131]  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     281111 (CYBA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B558a Cg6151-P DUF6030 COPI_assoc Motif Other DBs NCBI-GeneID:  281111 NCBI-ProteinID:  NP_776459 BGD-bta:  BT19863 Ensembl:  ENSBTAG00000051907 VGNC:  49140 UniProt:  O46521 LinkDB All DBs Position 18:complement(13886182..13893148) Genome browser AA seq 191 aa AA seqDB search MGQIEWAMWANEQALASGLILITGGIVATAGQFTQWYLGAYSIAAGVLVCLLEYPRGKRS KGSTMERCGQKYLTRVVKLFGPLTRNYYIRAFLHLGLAVPAGFLLATILGTACLAIASGI YLLAAIRGEQWSPIEPKPKERPQIGGTIKQPPSNPPPRPPAEARKKPSEEAAGVPTGGPQ ENPMPVNDEVV NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atggggcagatcgagtgggccatgtgggccaacgagcaggcgctggcgtccggtctaatc cttatcaccgggggcatcgtggccacggccggtcagttcacccagtggtacctgggcgcc tactccatagcagcaggcgtattggtctgcctgctggaataccctcgagggaagaggagc aagggctccaccatggagaggtgtggacagaagtacctgaccagagtggtgaagctgttc gggcccctcaccaggaactactacatccgggccttcttgcacctcgggctggcggtacct gctggcttcctgctcgccaccatcctggggacagcctgcttggccatcgcaagcggcatc tatctgctggcagccatccgtggggagcagtggagccccattgagcccaagcccaaggag cggccgcagattgggggcaccatcaagcagccgcccagcaaccctccaccccggcccccg gctgaggcccgcaagaagccgagtgaggaggcggcgggggtccccacgggtggcccccag gaaaaccccatgccagtgaatgacgaggtcgtgtga

DBGET integrated database retrieval system