KEGG   Bos taurus (cow): 505743
Entry
505743            CDS       T01008                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
bta  Bos taurus (cow)
Pathway
bta04927  Cortisol synthesis and secretion
bta04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    505743 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    505743 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ Pox_A9 T4SS_pilin
Other DBs
NCBI-GeneID: 505743
NCBI-ProteinID: XP_002684630
BGD-bta: BT10729
LinkDB
Position
1:complement(3183205..3197711)
AA seq 194 aa
MSGPPPDLPPSPTALISEEALSSETHRHTWMILHKSAGPSPGELGAAPEGPPGSDAGMAN
RTNISAPYYSYEYYLDYLDLMPVDEKKLRANKHSIVIAFWVSLAAFVVFLFLILLYMSWS
GSPQTRNATQQPPTCSWNLGLNLPLCIWRQPSTPGPHRARSRNQTPEHPGCPAATTREPL
NLSTPGTILLSSGN
NT seq 585 nt   +upstreamnt  +downstreamnt
atgtcaggcccaccccccgaccttcctcccagccccacagctctgataagtgaggaggcc
ttgagttcagagacccacagacatacttggatgattttacacaaatcagcggggccatct
cctggcgagctcggagcagctccggaagggccaccgggcagcgacgcaggcatggccaac
agaaccaacatctctgccccgtactacagctacgaatactacctggactacttggacctc
atgcccgtggatgagaagaagctgagagccaataaacattcgatcgtcatcgccttctgg
gtgagcctggcagctttcgtggtttttctcttcctcatccttctctacatgtcctggtca
ggctctccacagacaaggaacgccactcagcagcccccaacatgttcctggaatcttggc
ctcaacctcccgctctgcatctggaggcaacccagcaccccagggccccaccgagctcgg
tcgaggaaccagacgccggagcatcccggctgtccagcggctacaacgagagagcccctc
aacctcagcaccccagggaccatcctgctctcctctgggaactag

DBGET integrated database retrieval system