KEGG   Bos taurus (cow): 614780
Entry
614780            CDS       T01008                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    614780 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bta04050]
    614780 (TNFRSF8)
   04090 CD molecules [BR:bta04090]
    614780 (TNFRSF8)
Cytokine receptors [BR:bta04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   614780 (TNFRSF8)
CD molecules [BR:bta04090]
 Proteins
  614780 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 614780
NCBI-ProteinID: XP_002694100
BGD-bta: BT11160
Ensembl: ENSBTAG00000039937
VGNC: 36170
LinkDB
Position
16:complement(41561945..41636790)
AA seq 596 aa
MRALRAVLGLLLLGALRAFPQRRAPEDDCLGDLSRYYDKAARKCCHRCREGYSPKQLCPE
GSHHCERQCLHDYYLDSNDRCTACVSCSGDLVEKKPCSRNSSRVCECRAGMFCGTSVVNS
CARCIRHSVCPEGMVVKLQGTAQRDTVCEPAPPGASPNCSASPQDCKGPTSGTIPQAKPT
LTSPASPGARTMLLGGDIPLTPEDASKMTPNSSSFVVKLNPDPGLTLQPPCPRGSADCRK
QCNHDYYLDRDGRCKACVTCSGDGLVEKTPCTWNSSRVCECQPGMFCATPVTNSCARCVT
RPNCPPGMVTKLQGMAETGTTYEPLPPGSPPDCSTSPEDREAPASPTPSLVSLADSLTGK
EHGGGVTHAWEDTPGSTSAPISFSSTGKPALVSGPVLFWVILMLVVVVSFSSFVLCHRRA
CRKWIGQKLHLCYPVQTFRPTLEPVDSKPGRNPILTKSVSVADPGNEEQGLLSRPAMETC
LESLRLLEASPVSSPPSPTDLPEPRGTMEHTNNRIENIYIMKADTVIVGTVKAEVPEGQG
PVGPAGPELEEELETDYASHYPEQETEPPLGSCGDVMFSVEEEGKEDPLPTTVSDK
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgcgcgccctccgcgctgtgcttggtctgttgctcctgggggcgctccgagccttcccg
cagaggcgagcccctgaggatgactgtcttggagacctcagccgctactatgacaaggct
gccaggaagtgctgtcaccgctgtcgtgaggggtattccccaaagcagctgtgcccagag
gggtcccaccactgcgagaggcagtgtctgcacgattactacttggacagcaatgaccgc
tgcacagcttgtgtgagctgttctggagacctcgtggagaagaagccatgctcaagaaac
tcctcccgtgtctgtgagtgccgggctggcatgttctgtggcacatcagtggtcaactcc
tgtgcccgctgcatccgccactctgtctgcccagaagggatggttgtcaagttgcagggc
acagcacagagggacaccgtctgtgagccggctcccccaggggccagccccaactgcagc
gccagcccgcaggactgcaagggccccaccagtggcaccatcccccaggccaagcccacc
ctgacctccccagcaagccctggtgccaggaccatgcttcttggaggggacatccccctc
accccagaagatgcttctaaaatgactcccaactccagctccttcgtggtgaaactcaat
ccagatccagggctgaccctgcagcccccgtgccctcgggggtctgctgactgcaggaag
cagtgtaaccacgactactacctggacagggacggtcgctgcaaggcctgtgtgacgtgt
tcaggagatggcctcgtggagaagacaccttgcacatggaactcttcccgagtctgtgag
tgtcaacctggcatgttctgcgccacaccagtcaccaattcctgtgcccgctgcgtcacc
cgccccaactgcccaccagggatggtcaccaagctccagggtatggctgagacaggcacc
acctatgagccacttccaccagggagccctcctgactgcagcaccagcccggaggaccgt
gaggcgcctgccagccccaccccctccttggtctccctggctgactccttgactggaaag
gagcatggagggggtgtcacccacgcctgggaggacaccccaggctcaaccagcgctccc
atctccttctcctccacgggaaagccggctctggtttcaggacctgtgctcttctgggtg
attctgatgctggtggtagtcgtcagcttcagctccttcgtcctgtgccaccggagggcc
tgcaggaagtggattggacagaagctgcatctgtgctacccagtccagaccttccggccc
acgctggagcctgtggattccaagccggggaggaacccgatactgaccaagagtgtatca
gtggcagacccaggcaatgaggagcagggcttactgagccgcccggccatggagacctgc
ctggagagcctgcggctgctggaggccagcccagtcagcagccccccttcccccacagac
ctacctgagccccgagggaccatggagcataccaacaacaggattgagaacatctacatc
atgaaagccgacaccgtgattgtggggaccgtgaaagccgaggtgcctgagggccaaggc
ccagtggggccagccgggcccgagctcgaggaggagctggagacggactatgcctcccac
tacccggagcaggagacggagccaccgctgggcagctgtggggacgttatgttctcggtg
gaggaggaagggaaggaggaccccttgcccacgactgtctctgataaatga

DBGET integrated database retrieval system