Bemisia tabaci (sweet potato whitefly): 109037435 Help Entry 109037435         CDS       T06019                                  Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism btab  Bemisia tabaci (sweet potato whitefly) Pathway btab04013   MAPK signaling pathway - fly btab04068   FoxO signaling pathway btab04137   Mitophagy - animal btab04140   Autophagy - animal btab04150   mTOR signaling pathway btab04213   Longevity regulating pathway - multiple species btab04214   Apoptosis - fly btab04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:btab00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     109037435    04068 FoxO signaling pathway     109037435    04150 mTOR signaling pathway     109037435  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109037435    04137 Mitophagy - animal     109037435   09143 Cell growth and death    04214 Apoptosis - fly     109037435  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     109037435   09149 Aging    04213 Longevity regulating pathway - multiple species     109037435  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:btab04131]     109037435   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:btab04031]     109037435 Membrane trafficking [BR:btab04131]  Endocytosis   Macropinocytosis    Ras GTPases     109037435 GTP-binding proteins [BR:btab04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109037435 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin G-alpha Aldo_ket_red BsuBI_PstI_RE_N DUF6974 CdhD Motif Other DBs NCBI-GeneID:  109037435 NCBI-ProteinID:  XP_018907648 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNNAKSFEDISNYREQIKRVKDAEEVPMVLVGNKCDL PTRAVDSPVALKVAEQYGVPFIETSAKTRQGVDEAFYTLVREIRKDKEQRGRGKGKSFGK GRRKCYLF NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaaacttgtcgtcgtcggtgctggtggtgtcggtaaaagtgccttaacc attcaattaatccaaaatcattttgtggatgaatatgatcccacaattgaggactcttat aggaaacaagttgtcatagacggtgaaacatgtctgcttgacattttagacacagctgga caagaggaatacagtgctatgagagaccaatacatgaggactggtgaaggatttctactc gtctttgcagtgaacaatgccaagtcatttgaggatattagtaattaccgggaacaaatc aaaagagtaaaagatgcggaagaagtccccatggttttggtaggaaataaatgtgactta ccaacacgagcagtagattctccagtcgctttaaaagtagcggaacagtatggtgtcccc ttcatcgagacgtctgcaaagacaaggcaaggtgtggatgaagcgttttacacactggtc agagaaattaggaaagataaagagcaacgaggccgaggtaaggggaaaagttttggaaaa gggagaagaaagtgttacttgttttga

DBGET integrated database retrieval system