KEGG   Bemisia tabaci (sweet potato whitefly): 109044794
Entry
109044794         CDS       T06019                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
btab  Bemisia tabaci (sweet potato whitefly)
Pathway
btab00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:btab00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    109044794
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:btab00199]
    109044794
Enzymes [BR:btab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     109044794
Cytochrome P450 [BR:btab00199]
 Cytochrome P450, animal type
  CYP306 family
   109044794
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109044794
NCBI-ProteinID: XP_018918264
LinkDB
Position
Unknown
AA seq 507 aa
MVLSPVTSWILHLAFLTFCASLVQWLIRYVQHLRRLPPGPYGLPVIGYLPWIDPKKPHIT
LTNLVSKYGKIYSLKFGNLTTIVLADPVLIREAFRKDVFSGRADLYVTHGIMEGYGLIVP
EGERWKEQRQFAVSTLRDLGMVKFGAKRSHMEQRIMKGVQALFRSLDAFGGSDVDLTHPL
FHSVGTVMYSLVLGKTWDHDDPMWIWLREKMEEGVQMMQVAGPINFLPWLRFIPKFRKMI
EFLISGKKKEHALYEQFFKENQGILGEADSLATAYRLEMERRQDSPQGSHSFVREQCDHF
LADLLGAGTDTTCTSIKWFLLLLVIHPQVQAEIQEELEQLECVDGLIGLEGMEDAVLLRA
AFAESMRLRPLTTLGIPHATRAATDLAQFHIPERSMVIPLLWAINMDPQLWTDPLEYRPR
RFIDENGRFAKPDHFMPFQVGKRMCLGDELARMMTFLFCANVLHRYKITSPNTPEELQNA
LDGDCGLLYVPKKYVLNFHIRERNVDR
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggtgttatccccggtgacgtcatggatcctgcatctcgccttcctcactttttgcgca
tctctggtccagtggttaatccgttacgtccagcatttgcgaaggttaccgcctggccct
tatgggcttccagtcattggatacctgccttggattgaccccaagaagcctcatattacc
ctcacaaatttggtgtctaagtacggaaaaatatactctctgaaattcggtaatttgaca
actatcgtgctcgctgacccggtgctaatcagggaggctttcagaaaggacgtcttctcc
ggcagagcagatttatacgtcactcatggtattatggaaggctatggcttaatcgtgccc
gaaggagaaagatggaaggagcagcggcagtttgcagtatctacactgagagatttaggc
atggtgaagttcggtgcaaaaagaagtcatatggaacaaaggataatgaaaggcgtgcag
gccttatttcggtccctagatgccttcggagggagtgatgtggacctgactcaccctctc
tttcattcggtaggcacagtgatgtattctctagttttgggcaaaacttgggaccatgac
gatccgatgtggatttggcttcgggagaaaatggaagaaggagtccaaatgatgcaggtc
gcaggtcctatcaattttctcccttggttgagattcataccgaagttcaggaagatgatc
gagttcctgatcagtggaaagaaaaaggagcacgcactctacgagcaatttttcaaggag
aatcagggaatcctcggtgaggcggacagccttgcgactgcttacaggctggaaatggag
aggcggcaggactccccgcaggggtcccactctttcgtaagggagcaatgtgaccacttt
ctggccgatctccttggcgctggaactgacactacttgcacctccatcaagtggttcctc
ttgctacttgtgatccatccccaagttcaggcagagatccaggaggaattggagcaactg
gaatgtgtggacggattgatcgggctcgaggggatggaggatgctgtgctgctgcgagct
gcgttcgctgagtcaatgcgtctccgtcccctgacgaccctcgggataccccacgcgacg
agggccgccacggacctggcccaattccacatccccgagagaagcatggttatacccctc
ctctgggccatcaacatggacccccaactttggaccgatcccctggaataccgcccaagg
cgcttcatcgacgagaacggtagattcgccaagcccgaccacttcatgcccttccaagtc
ggtaaaagaatgtgtctaggtgacgagctggcaaggatgatgaccttcctcttttgtgcg
aatgttttgcacaggtacaaaataacttcacccaatacgccagaagaacttcagaatgca
ctcgacggagattgtgggctcctatacgttccgaagaagtatgtgctaaattttcacatc
cgggagcgaaatgtagacagataa

DBGET integrated database retrieval system