Budorcas taxicolor (takin): 128069036 Help Entry 128069036         CDS       T08909                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism btax  Budorcas taxicolor (takin) Pathway btax00510   N-Glycan biosynthesis btax00513   Various types of N-glycan biosynthesis btax04141   Protein processing in endoplasmic reticulum Module btax_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:btax00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     128069036 (TMEM258)    00513 Various types of N-glycan biosynthesis     128069036 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     128069036 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  128069036 NCBI-ProteinID:  XP_052518289 LinkDB All DBs Position 25:complement(40923188..40926859) Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYI NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaacttgaggccatgagcagatacaccagccccgtgaacccggctgtctttccccac ctgaccgttgtgctgctggccattggcatgttcttcaccgcctggttcttcgtttatgag gtcacgtccaccaagtacacccgggatatctacaaagagctcctcatctccctggtggcc tcactcttcatgggctttggagtcctcttcctgctgctctgggtcggcatctacatatga

DBGET integrated database retrieval system