Burkholderia thailandensis E254: BTN_2852 Help Entry BTN_2852          CDS       T03380                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bthe  Burkholderia thailandensis E254 Pathway bthe02024   Quorum sensing bthe03018   RNA degradation Brite KEGG Orthology (KO) [BR:bthe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BTN_2852 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BTN_2852 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bthe03019]     BTN_2852 (hfq)    03036 Chromosome and associated proteins [BR:bthe03036]     BTN_2852 (hfq) Messenger RNA biogenesis [BR:bthe03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BTN_2852 (hfq) Chromosome and associated proteins [BR:bthe03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BTN_2852 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AIT21372 LinkDB All DBs Position 1:complement(3214819..3215058) Genome browser AA seq 79 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARPVNFHPDAEAAS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaattgttacaagacccgtttttgaacgcactgcgtaaagagcac gtgccggtttcgatctatctcgtgaacggcatcaagctccaagggaacatcgaatcgttc gaccagtacgtcgtgttgctccggaacacggttacccagatggtttacaagcacgccatt tcgacggtcgtgccggcgcgtccggtgaacttccacccggatgcggaagcagcgtcctaa

DBGET integrated database retrieval system