Bacillus tropicus: FJR70_00845 Help Entry FJR70_00845       CDS       T06661                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism btro  Bacillus tropicus Pathway btro02024   Quorum sensing btro03018   RNA degradation Brite KEGG Orthology (KO) [BR:btro00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     FJR70_00845 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     FJR70_00845 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:btro03019]     FJR70_00845 (hfq)    03036 Chromosome and associated proteins [BR:btro03036]     FJR70_00845 (hfq) Messenger RNA biogenesis [BR:btro03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      FJR70_00845 (hfq) Chromosome and associated proteins [BR:btro03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     FJR70_00845 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM DUF5608 Hfq_1 Motif Other DBs NCBI-ProteinID:  QDF21670 LinkDB All DBs Position 157865..158053 Genome browser AA seq 62 aa AA seqDB search MEHLQDELYKQIKEEKGIVTIFLKSGVRIVGEVVAIDKFTVLMLVDGKQQLIYKQAISAI MK NT seq 189 nt NT seq  +upstreamnt  +downstreamnt ttggaacatttacaagatgagctatataaacaaataaaagaagaaaaaggtattgttaca atttttttaaagagtggcgttagaatagtaggagaagttgttgcaatagataaatttacc gttttaatgttagttgacggaaaacaacaacttatttacaagcaggctatatcagcaata atgaaataa

DBGET integrated database retrieval system