Burkholderia sp. JP2-270: DM992_03045 Help Entry DM992_03045       CDS       T07766                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism burk  Burkholderia sp. JP2-270 Brite KEGG Orthology (KO) [BR:burk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:burk03036]     DM992_03045    03400 DNA repair and recombination proteins [BR:burk03400]     DM992_03045 Chromosome and associated proteins [BR:burk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM992_03045 DNA repair and recombination proteins [BR:burk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM992_03045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS HalX Histone_HNS_N P22_Tail-4 Motif Other DBs NCBI-ProteinID:  AWU98652 UniProt:  A0A2U9SGA4 LinkDB All DBs Position 1:complement(633953..634249) Genome browser AA seq 98 aa AA seqDB search MSQYAKLKAQIADLQAQADDVRRQEVAAVIADVQRMIAEYGLTAQDLGFAERARRGRPPK KAPLPPKYRDPKSGATWSGRGKPPNWIVGKNRDRFLIE NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcaatacgcgaaactcaaggcgcagatcgccgatctgcaggcccaggcggacgac gtacgccgccaggaagtggcggcggtgattgccgacgtccagcgaatgattgccgaatac ggcctgacggcccaggacctgggcttcgcggagcgagcgcgacgcggccgcccgccgaag aaggcgccgctgcccccgaaataccgtgatccgaagtcgggtgcgacctggagcgggcgc ggcaagccgccgaattggatcgtcgggaaaaaccgcgatcgattcctgatcgaatga

DBGET integrated database retrieval system