KEGG   Paraburkholderia phytofirmans OLGA172: AYM40_04920
Entry
AYM40_04920       CDS       T05111                                 
Name
(GenBank) catechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
buz  Paraburkholderia phytofirmans OLGA172
Pathway
buz00361  Chlorocyclohexane and chlorobenzene degradation
buz01100  Metabolic pathways
buz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:buz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    AYM40_04920
Enzymes [BR:buz01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     AYM40_04920
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Other DBs
NCBI-ProteinID: ANB71786
UniProt: W8JJE3
LinkDB
Position
1:1150724..1151491
AA seq 255 aa
MNNRIKDVVDTIVSAVQRALDEKEVTESEYRTAVHYLMEVAQQREIALLCDVFFNSTVVA
TKARLSDGSTPAIEGPYYRDDAPLVEDRLKSYDTDDHKPLLIQGTVKGVDGSVIENVTID
VWHSTPDGKYSGFHDDIPTDFYRGKLRVGTDGGFRVRTTMPVAYQIPNQGPTGALLETMG
GHSWRPAHVHFKVNAPGYETLTTQYYFEGGDWVTDDCCNGVESSLITPDIVQDGARVMNI
NFVIEPARSQAGANA
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgaacaacagaatcaaggatgttgtcgataccatcgtgtcggcggtacagcgggcgctc
gacgagaaagaggtcacggagtcggaatacagaaccgcggtccattacctcatggaggtc
gcgcaacagcgtgaaattgcgctgctttgcgacgtattcttcaacagcaccgtcgtggcg
acgaaggcccgtcttagcgacggctcaacgcctgcaatcgaagggccctactatcgtgac
gacgctccgctggtcgaagaccggctcaagagttacgacacggacgaccacaagccgttg
ctaatccagggaacggtcaaaggggtcgacggaagcgtgattgagaacgtaacgattgat
gtctggcattcgactcccgacggcaagtacagtggttttcatgacgacattccgaccgat
ttctatcgaggcaaactccgggttggcaccgatggcgggttccgtgtgcgaacgacgatg
ccggtcgcctaccagattccaaatcagggtcctaccggcgcattgcttgaaaccatgggt
ggtcactcgtggcgtccggcccacgtgcatttcaaggtgaacgcgccggggtacgaaacg
ctgacgacccagtactactttgaaggaggggactgggtcacggacgactgttgcaatggc
gtcgagtccagtctgatcacacccgacattgtgcaagatggcgctcgcgtgatgaacatc
aatttcgtaattgagcccgcgcgttcgcaggcgggagcaaacgcatga

DBGET integrated database retrieval system