KEGG   Bombus vancouverensis nearcticus: 117154738
Entry
117154738         CDS       T07628                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
bvan  Bombus vancouverensis nearcticus
Pathway
bvan00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:bvan00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    117154738
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bvan00199]
    117154738
Enzymes [BR:bvan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     117154738
Cytochrome P450 [BR:bvan00199]
 Cytochrome P450, animal type
  CYP306 family
   117154738
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 117154738
NCBI-ProteinID: XP_033185870
LinkDB
Position
Unknown
AA seq 499 aa
MNFIYAIFVLFVSVLVYVFYINRKVRRLPPGPWQLPIVGYLPWIDAEKPHETLTNLARVY
GPICGLRMGSVYTVLLSDPQLIKQTFSKDMSTGRAPLYLTHGIMKGYGLVCAEGERWKDQ
RKFVSNCLRNFGMIKHEGPKREKMEKRISDAANECATALKNRGANGPIDPLNTLHHCMGN
LVNSIVFGKTYKEEDEVWKWLRHLQEEGVKEIGVAGPLNFLPFLRFLPRYGRTIQSIVDG
KEKTHKVYREILEEHRAQIAQASENTDRVESFLAAFDEQMRKENGTKSEFFTEPQLYHLL
ADLFGAGTDTTLTTFRWFLLFMAAHPTEQEKVQSEMDLCLKEGEQPTLDDRIAMPRLEAA
IAEVQRIRTVTPLGIPHGTSEDMRIGDYDVPRGTMIVPMQWAIHTDPAYWQDPLEFRPDR
FLSDDGSFFKPESFLPFQSGKRICVGEELARMILFLFAGRILRAFVISVPPDEIVDLEGD
CGITLVPKPHRLMFVPRHH
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgaacttcatttacgcgatattcgttttattcgtttccgttcttgtatacgtcttctat
ataaatcgaaaggtacgtcgtctaccacctggtccttggcaacttccgatcgtcggctat
cttccatggatcgatgcagaaaaaccacacgaaactctgacgaatttagccagagtttat
ggtcctatatgtggactccgcatgggttccgtttatactgttttattgtcggatcctcaa
ttaataaagcagaccttctcgaaagatatgtccaccggtagagcacctttgtaccttaca
cacgggattatgaagggatatggtttagtttgcgcggagggagaacggtggaaggatcag
agaaaattcgttagcaattgcttacgaaactttggaatgataaagcacgaaggaccaaag
cgcgagaaaatggagaaacgaatatccgatgcagcaaatgaatgtgcaacggcactgaaa
aatcgcggggcaaatggaccgatcgatccattaaatacgcttcatcattgtatgggtaat
cttgttaatagcatcgtatttggaaaaacctataaggaggaagacgaagtttggaaatgg
ctaagacatttgcaagaagaaggagtgaaagaaattggtgtcgctggaccgctcaacttt
ttaccttttctcagattcttaccacgatacggccgaacgatacaatcgatcgtcgatgga
aaggagaaaacgcataaagtatatcgggaaatactcgaagaacaccgcgcacagatcgcg
caagcatcagaaaatacggatagagtcgagagctttctggcagcattcgacgaacaaatg
aggaaagaaaacggtacaaaatccgagtttttcacagaaccccaactgtaccatttatta
gcagatctttttggtgctggaactgatactactttgaccacctttcgttggtttctctta
ttcatggctgcccatcctacggagcaggaaaaggtacaatcggagatggatctatgtttg
aaggaaggggagcagccgactctagacgatagaatcgctatgcctcgtctcgaggctgct
atagccgaagtgcagaggataaggactgttacaccactcggtattcctcatggaacatca
gaggatatgcggataggtgattacgatgtaccacgcggtaccatgatcgtgccgatgcag
tgggctattcacaccgatcctgcttactggcaagatcctctcgaatttcgacccgacaga
ttcctatccgatgatggaagtttcttcaaaccggaatcgtttctcccatttcaaagtgga
aaacgcatttgcgtgggagaggaactcgctaggatgatactatttttgttcgccgggagg
atactgcgcgcattcgttatatccgtaccaccggacgagatcgtcgatctcgaaggcgat
tgtggcattacgttagttccgaaaccacatcgcttgatgttcgttccacgacatcattaa

DBGET integrated database retrieval system