KEGG   Beta vulgaris (sugar beet): 104896004
Entry
104896004         CDS       T03548                                 
Name
(RefSeq) anthocyanidin 3-O-glucosyltransferase 6
  KO
K15775  betanidin 6-O-glucosyltransferase [EC:2.4.1.-]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00965  Betalain biosynthesis
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    104896004
Enzymes [BR:bvg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     104896004
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 104896004
NCBI-ProteinID: XP_010680969
LinkDB
Position
6:15154108..15155898
AA seq 492 aa
MSSSTASLTVTADAELVFVPAPGMGHLKSAVELAKLIIQRNHRISIVILIINIPTTTSLI
NDFIHSQSRNNPYPTHLTFITLPPLSNPPERSSPEFMRILIELHEPLVKQAVEERIQAGS
SKLAGFVLDMFCTNMIDIATNLNVPAYIFFTSGANMLSLMFHFQSMNDEGVFDLTKDHIS
PNAEFDVPGFVNRVPEKVLPAVLIDKESGVPMLLNLVRGLRRSKGILVNSFTELETSGVQ
ALLDQATEGGSIPAIYPVGPILELDSGSQGEDHVSILQWLDKQPSSSVVFLCFGSMGSFD
ANEVKEIANGLEKSGHRFLWSLRKPPSAGTTQSSQDQTFVEALPEGFVDRTAKIGKIISW
APQVSILSHPSVGGFVSHCGWNSTLESMWFGVPVATWPLHAEQQLNAFELIKELGLAVEI
RMDYRHDWKTRKANFVVTAEEVENGVQKLMSLDEETKKRVRQMRDEGRKALEDGGSSHMS
LARFIQDVLTFE
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgagcagcagtacagcaagtctaacagtaacagcagatgcagagctggtgtttgttcca
gctccgggtatgggccaccttaaatccgccgtggaactagccaaactcatcatccaacgc
aaccaccgcatttcaatcgtcatcctcatcatcaacatccccactactacttcccttatc
aacgacttcattcactcccaatcacgcaacaacccttaccctacccatctaactttcatc
actctaccacctctttcaaacccaccagaacgttcatctcccgagttcatgcgcattctc
attgagctccacgagcctctcgtcaaacaggccgtcgaggaacgaatccaagccgggtct
tctaagcttgccggtttcgtcctcgacatgttttgcaccaacatgattgatattgccact
aatttaaacgttccagcctatatcttctttacttcgggagctaacatgttaagtcttatg
tttcattttcagtcaatgaatgatgaaggtgtttttgatcttactaaggaccacatcagc
cccaatgctgagtttgatgtacccgggtttgtgaaccgggtacccgagaaagttctccct
gcagtacttattgataaggaaagtggggtccctatgcttctcaaccttgtgagggggtta
agaagatccaagggtattttagtaaattcatttacagagcttgaaacttccggtgtacaa
gctttgttagatcaagcaactgaaggtggtagcattcccgctatttatccagtgggtccc
atcttagagcttgacagtgggtcccaaggagaggaccacgtgtctattttacagtggcta
gataagcagccttcttcatcagtagtgttcctctgctttgggagcatgggaagttttgat
gcgaatgaagtgaaggagatagctaatggtcttgaaaagtccggacaccggtttctctgg
tctctacggaagccgccttccgcgggtacaacgcagtctagtcaggaccaaacttttgta
gaagccttacccgaaggctttgtggatcggacggctaagatcggaaaaatcattagttgg
gcaccacaagtctccatcttgtcccatccttccgtaggtgggttcgtatcgcattgtggg
tggaactcgacactggagagtatgtggttcggggttcctgtagcgacgtggccactacat
gcagagcaacaactgaatgcatttgaattaatcaaggagttgggattagcggttgagatt
aggatggactatcgacatgattggaaaacaagaaaagcaaactttgtagtcacagctgag
gaggttgagaacggtgtacagaaattgatgagtttggacgaggagacgaagaagagagtg
aggcaaatgagagatgaaggtagaaaagctttggaagatggtggttcttctcatatgtcg
ttggctcgttttattcaagatgttttgacttttgagtaa

DBGET integrated database retrieval system