KEGG   Beta vulgaris (sugar beet): 104896332
Entry
104896332         CDS       T03548                                 
Name
(RefSeq) UDP-glycosyltransferase 92A1
  KO
K15776  cyclo-DOPA 5-O-glucosyltransferase [EC:2.4.1.-]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00965  Betalain biosynthesis
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
Module
bvg_M00961  Betacyanin biosynthesis, L-tyrosine => amaranthin
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    104896332
Enzymes [BR:bvg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     104896332
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 104896332
NCBI-ProteinID: XP_010681410
LinkDB
Position
1:1477583..1479881
AA seq 481 aa
MKMESETTKHILLLPYLAQGHLRPFLHLAHRLHSHTPFTISLLTTPLNAANLRRLNDNIE
ININELPFNSCDHGLPPNTENTDKLPLTSIITLFCASTSLEPHLRDYLTRHHLHSPPVCI
IFDICLGWADNVARSFGSIGIGFNTSGAYGVAAYVSIWNHLPHRNVSDDEEFLVPGFPEN
QKFQRNQLHRFLDTADGSDDWCRFIQLQLRLSMKCSGWLSNTVEEIEPLGFEILRNVIKI
PVWGIGPTIMTSSSNDNDEACLEWLNQCKKESVLYICFGSQNTVTPAQIMELAKGLEESI
VSFLWVIRPPLGFDFNGEFKPEWLPEGFEERMREKKQGKLVRKWAPQLEILKNAAIGGFL
SHCGWNSVVESLTEAVPIIAWPLAAEQAYNSKMLVEEMGVAVELTRGLEGEVKKEKVKRV
VEMVLDRSEGSCGWEMKKKAVEIGEKMRDALKVEGDYKGSSIRAMEDFLEFIVSFRGKEV
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaaaatggagtcagaaacaacaaagcacatcctcctcctcccatacttagctcaaggc
cacctccgccctttcctccaccttgctcaccgccttcactctcacactcctttcaccatc
tctctcctcaccacccctcttaatgctgccaatcttcgccgcctaaatgataatattgaa
atcaacatcaatgagcttccctttaacagctgcgaccacggcctccctcctaatactgaa
aacactgacaaactccccttaacctcaatcatcactctattctgtgcctccacctctctt
gaaccgcatctccgcgactacctcacgcgccaccatcttcacagcccacctgtgtgcatt
atctttgacatttgtttgggttgggctgacaatgtggcccgatcattcgggtccattgga
attggttttaacactagtggggcctatggcgtagcggcatatgtctccatctggaatcat
cttcctcatcgaaatgtctctgatgacgaggaatttttggttccaggattccccgaaaac
caaaaatttcaacggaatcagcttcaccggtttttagatactgctgacggttctgatgat
tggtgtaggtttattcagctccagcttagattgtctatgaagtgttctgggtggttgtct
aataccgttgaggaaattgaacctttgggatttgaaattctgaggaatgtaataaaaata
cccgtttggggaatcggacctacaattatgacctcttcttcaaatgataatgatgaagct
tgtttagagtggttgaaccaatgcaaaaaagaatctgttttgtacatttgtttcgggtca
cagaacactgtgactccagcgcaaattatggaactagcaaaagggttagaagaaagtatc
gtttcattcttatgggtaatccgtccaccacttgggtttgatttcaatggggagtttaaa
cccgaatggttgccggaagggtttgaggagaggatgagggagaagaaacaagggaagttg
gtacgaaaatgggcgcctcaattggagattttaaagaatgcagcaatagggggattcttg
agtcattgtgggtggaattcggtggtggaatctttaacagaggcggtgccgataatagca
tggcccttggcagctgagcaagcgtataactcaaagatgttggtggaagaaatgggggtt
gcggttgagttgacgaggggtttggaaggggaggtaaagaaagagaaggtgaagagggta
gtagagatggtgttggatagaagtgaggggagttgtgggtgggagatgaagaagaaggct
gtcgaaatcggggagaaaatgagggatgctctgaaagtggagggagattacaaggggtct
tctattagggcaatggaagattttttagagttcatagtttccttcaggggtaaggaagtg
gcatga

DBGET integrated database retrieval system