KEGG   Beta vulgaris (sugar beet): 104904988
Entry
104904988         CDS       T03548                                 
Name
(RefSeq) scopoletin glucosyltransferase
  KO
K15774  betanidin 5-O-glucosyltransferase [EC:2.4.1.-]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00965  Betalain biosynthesis
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
Module
bvg_M00961  Betacyanin biosynthesis, L-tyrosine => amaranthin
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    104904988
Enzymes [BR:bvg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-
     104904988
SSDB
Motif
Pfam: UDPGT
Other DBs
NCBI-GeneID: 104904988
NCBI-ProteinID: XP_010691730
LinkDB
Position
9:45152461..45154803
AA seq 485 aa
MGAEEFHVVLFPFMAHGHMIPILDIARLFAVRDNVKATIITTPLNVTNFTKDNESNMESS
APIVNIEVFRFPAQEVGLPEGFENLEKVMKPELLNKFFKAAGMLNEQLEQYLEKIRPNCL
VADMFFPWATESAAKFNIPRLVFHGTSNFALCAQEIVRLYKPFKNVTSDEEPFVLPSLPH
DIQMRRLQIPEDLWKYDGTEFEKRMDSLKDSEIKSYGVLVNSFYELEPDYAEFFKKELGR
KTWNIGPVSLSNRSVKDKSQREKEPLIDQHECLKWLNSKKPDSVVYICFGSTASFIAPQL
HEMALALEVSGQEFIWIVKNDENGRSKEWLPPGFEQRTEGKGLIIRGWVPQVLILEHEAI
GAFVTHCGWNSTLEGISAGVPMVTWPIFAEQFYNEKLVNQILNTGVPVGAKKWSRTPSIE
DIIKMEAIEEALTDIMVGTEAEERRTRAKKLKILAYKAVEEDGSSYSDLTALINELSANR
LQEQE
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgggtgctgaagagtttcatgtagttctatttccattcatggcgcatggccatatgatt
ccgatccttgatatagcgcggctctttgcagttcgcgataatgtgaaggctaccattatt
accaccccactcaacgtcaccaatttcaccaaagacaatgaaagcaacatggaaagcagt
gctccaatcgttaatattgaggtgttcaggtttcctgcacaagaagttggcttacctgaa
ggttttgaaaatttggagaaagtaatgaaacctgagttactcaacaaattcttcaaagct
gcagggatgctaaacgagcagctcgagcaatacttagagaagatacgacctaactgcctt
gttgctgatatgtttttcccttgggcaactgagtcagcagccaagttcaacatcccaagg
ctagtctttcatggtactagcaactttgccctttgtgctcaagagattgttaggctatat
aagccttttaagaatgttacatctgacgaagagccatttgttcttccttcactcccccat
gatatacagatgagaagattgcagatcccagaagatttgtggaaatatgacggaacagaa
ttcgaaaagaggatggatagtttgaaggactcagagatcaaaagttatggagtgcttgtt
aacagcttttatgagttagaaccagattatgcagagttcttcaaaaaagaattgggaagg
aagacttggaatataggccctgtttcattaagcaacagaagtgtaaaagataaatctcaa
agagagaaagaacctttgattgatcaacatgagtgcttgaaatggcttaactcaaagaaa
cctgattcggtagtttacatctgttttggaagtacagcaagtttcatagctcctcaactg
catgagatggcactggccctagaagtgtcagggcaagaattcatctggatcgtaaagaac
gatgagaatggaagaagtaaagagtggctgccaccaggatttgaacaaaggacggaaggg
aaaggattaattattagggggtgggttccgcaggtgctaatcctagagcatgaagccata
ggagcttttgtgactcactgtgggtggaattcaacactagaagggatctcagctggcgtt
ccaatggttacatggcctatttttgccgagcaattctacaacgaaaagttggtaaaccag
attttaaatactggtgtccctgtcggagcgaagaagtggagtaggacaccttctatagag
gatatcattaagatggaagctatagaggaagcattgacagatattatggtgggaacagag
gcagaggagagaagaacaagagcaaaaaagctgaaaattttggcatataaggctgttgaa
gaagatggttcatcatattcagacttaactgcattgataaatgagttaagcgctaatcgc
ctacaagagcaagagtag

DBGET integrated database retrieval system