KEGG   Bacillus vallismortis: B9C48_09410
Entry
B9C48_09410       CDS       T04948                                 
Name
(GenBank) non-ribosomal peptide synthetase
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bvm  Bacillus vallismortis
Pathway
bvm01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    B9C48_09410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bvm01008]
    B9C48_09410
Polyketide biosynthesis proteins [BR:bvm01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    B9C48_09410
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: ARM28033
LinkDB
Position
complement(1960447..1968084)
AA seq 2545 aa
MGQQPEIQDIYPLSFMQEGMLFHSLLDHDSRAYFEQAVFTINGQLDRERFQKSIDAVFER
YDIFRTTFIHKNVAKPRQVVLKNRPSRVQFHDISHLDEKAQDKYADRFRKEDKDKGFDLQ
SDPLMRVSILKKAPERYVCIWSHHHIVMDGWCFGIVMKEFLMIYQSLGDGRLPSLEPVQP
YGKYIKWLMKQDRKEAEIFWNMRLADLEQSASLPKKSAEPNGELEQAVFTISEEQTNGLK
NIAARAGATLNTVFQALWGMLLQRVSRCDDAVFGSVVSGRPSDLAGVEKMVGLFINTIPV
RVKSGSFSFLELVRHLQQETLQAEAYSYYPLYDIQAQSPLKQALFDHIIVFENVPAQREI
ENVSQAGSFDFAVEDFTMEEVTNYGCSIKVIPENSLYIRLNFDTGIYDRVFMKNIETFLR
HMMKSVISDPEMSASEIALLDACEARNMLDAFNRTETVEPPAPTLHGLFARRAALSPHRP
ALRFPGGMLTYAELDQYTDRLAVRLRQKGIRKESMVGVLAERSPEMVVSVLAVLKAGGAY
VPLDPDYPEDRLRYMLDDCGACLLLAQPGLSVSGFSGETLEVSLSALTGETETGAVSEEA
DSASLAYIIYTSGSTGTPKGVAVEHRQAAAFLSGMQGQFPLTEEDVIVLKSSFSFDASIW
QLFWWTMSGASVYLLPAGWEKDPVRMIEAFASEKVTTAHFIPAMVNSFLDALETEPEETR
TRLGRTLTRVFAGGEALSPLTAARFADLLPETMLIHGYGPTEATVDAAFYVCDRKRDSGR
TRLPIGKPVPGARLYVLDSGGTIQPAGVAGELYIAGTGVARGYLNRPELTEERFLDDPFY
PGERMYQTGDIARWTEDGLVEWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTPR
TEHGETALYAYIEGRESDDVRAELATRLPAYMMPAQFIKMSEWPVTPSGKLDRRALPAPG
GAADTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFGVQVP
LQDIFARPTVEELASVIQDLEESPYEAIQPAKKQDTYPVSSAQKRMYVLQQLEDGGVGYN
MPAVLELTGPLDRSRLEETFRQLVERHESLRTSFETGPDGEPVQRIHDSVPFQLDEAESA
DAFVRPFCLEEAPLFRAALVKESDERHLLLTDMHHIISDGVSVNTLIKEFGELYAGRSLA
PMRLQYKDYAVWQRSFQEKEGYQKQEAYWLKRLEGELPVLELPADKPRPAVRSFAGGSVS
CTLDAETASGLHRIARDHGSTLYMVLLAAYNTLLARLSGQEDIIVGSPIAGRPHKDLEPI
LGMFVNTLAIRTEPKGDKRFTDYLAEVRQAALEAYEHQDYPFEELVERLGVQRDMSRNPL
FDVMFVLQNMERESLVLNKLHLAQAADTSHKTAKFDATLYASEGSDGSISFDFEFNTDIY
QKQTIEKWLSYFTRILTKVIENQAIPLGDIHVLDNAETNRVIYQFNQTKSDYPRHETISR
LFERQAKETPDARAVVYDGQILTYRELNERANRIAAALRSNGVGPESVVALLTGRTTELA
SGILGILKAGGAYLPIGDDVPRERAEWMLKDCKADILLQSDKLDGLPLSGKRLFIEDIQT
KAGLSSENPEPLGGPESLAYMIYTSGSTGAPKGVMIEQRSVIRLVKNSNYIDFTPEDRLL
FTSSLGFDVTTFEIFGPLLNGASLYVSDQETYLDSDVLETFIQQNGITTLWLTSSLFNHL
SEQNEHVFSGLSRLIIGGEALSPSHVNRVRSALPHLSVWNGYGPTENTTFSTCFLIEQSY
DHSIPIGRPVGNSTAYIINSRGTPQPIGVIGELCTGGDGVARGYFGRPELTEEKFVPNPF
VPGERMYRTGDLARWLPDGTIEYAGRMDDQVKIRGYRVELGEIEAALRSLDGVKEAAVSV
RTGQSGNKELIAYMSLQADMDTEKVRSLLSRQLPNYMVPAYMMELEKLPLTPNGKLDRKN
LPEPELALQTAYTAPRNELEEQLSVIWQEVLGTKQVGIEDSFFELGGDSIKALQVSARLG
RYGWKMTASDLFRHPSIKELAPLIRKAERVSDQRPVEGDIPWTPVQHWFLSQRMENRNHF
NQSVMMFSSDALHKQPLKEALKHLVIHHDALRITVSAENESFRQINHGIQNAELYSLDIW
DLSETDTWEREIETEVAALQQRMDIEKGPLLKAGWFKTRSGDYLFITVHHLAVDGVSWRI
LLEDLSAAYTQAVKGQPVQLPPKTDSFKQYAVRLSEYAKSSKLMHEEEYWRFIEEETAAE
LPYEKPQHQTGADSIRQTVSFTLTEEETSVLLQQVNRAYHTDTQDILLTAAALALRDWTG
GGRLRIAMEGHGREHIMPELDISRTVGWFTSMYPVLIDLNTAGAELGTAVKTVKDTLGRI
PDKGIGYGILKYMTPPEQKTIRFRQAPEISFNYLGQFNDTEDQHTFSLSGLASGHDITPT
WQREQAVEMSAMAAQNKLHFSLSYPPSRFRKETMEQLLQTLQQYLRDIMAHCTGKEEAEK
TVSDFSSKTLTSDDLDSIASFVEEL
NT seq 7638 nt   +upstreamnt  +downstreamnt
atggggcagcaaccggaaatacaagatatatatcctttatcttttatgcaggagggcatg
ctttttcattctctgttggatcatgactcaagagcctacttcgaacaagcggtgtttacg
atcaacggacagcttgaccgggaacgattccaaaaaagtatagatgctgtttttgaacga
tacgatattttccgtacgacatttattcataagaatgtggcgaagccccgccaagtcgtg
ttgaaaaacagaccaagccgcgttcagtttcatgatatttctcatttggacgagaaggca
caagacaaatatgccgaccggttcagaaaagaagataaagataaaggctttgatttgcaa
tcagaccctctcatgagagtctccattttgaaaaaagcgcctgaacgctatgtttgtata
tggagccatcatcatatcgtcatggacggctggtgcttcggaattgtcatgaaggaattt
ctgatgatctatcaatctctcggagacggacggctcccgtctctcgagcctgttcagcca
tatggaaagtatattaaatggctcatgaagcaggatcgtaaagaagccgagattttttgg
aatatgagacttgccgatcttgagcaatcggcgtctcttccgaaaaaatccgcggaacca
aatggcgaacttgagcaggcggttttcaccatttcggaagagcagacaaatgggctgaag
aacattgcggcaagggcgggagcaacgctgaatacagtgttccaggcactgtggggcatg
ttgctgcagcgtgtcagccgctgtgatgacgccgttttcggttctgtcgtttccggccgg
ccgtcggatctcgcaggcgtggaaaaaatggtaggactgtttatcaatacgattcccgtg
cgggtgaaaagcggttcattttcttttctggagctcgtcaggcatttgcagcaggagacg
ctgcaagcagaagcgtacagctattatccgctgtatgacattcaggcgcaaagccctctg
aagcaagcgctgtttgaccacattatcgtgtttgaaaatgtgccggcccagcgtgaaatt
gaaaatgtgagtcaggccggttcatttgattttgcggtagaagatttcacgatggaggaa
gtcacaaactacggatgcagcataaaggtgattccggaaaattctctttatatccgctta
aactttgataccggtatatacgatcgtgtttttatgaagaatattgaaacatttttacgg
catatgatgaagtcagtcatttccgaccctgaaatgagcgcctccgagatcgcattgctg
gatgcgtgtgaagccagaaatatgctggatgcgtttaaccgtacagaaacggttgaaccg
ccggctccgacgcttcacgggctgtttgcccgccgcgccgcgctttcgccgcatcgtccg
gcgctccgttttccgggcggcatgctgacgtacgctgagctcgaccagtacacagacagg
ctcgccgttcggctccgccaaaaaggcatccgcaaagaaagcatggtcggcgtactcgct
gaacgctcgccggagatggtggtttcagtgcttgccgtgttaaaagcgggcggcgcctac
gtgccgcttgaccctgactatcctgaggacaggctgcgctatatgctcgacgactgcggc
gcttgtcttctgcttgcacagccgggattatccgtttccggtttttccggagaaacgcta
gaagtgtctctttctgctctgacaggcgagacggagacaggggctgtctctgaagaagcg
gatagcgcttcgctcgcttatatcatttatacgtccggttcgacgggaacaccgaaggga
gtggctgttgaacaccgtcaggccgccgcctttttatcagggatgcaagggcagtttccg
ttaacggaagaggatgttatcgtgctgaaatcatccttttcattcgacgcctctatctgg
caattgttttggtggacgatgtcaggcgcctccgtgtatctgcttcctgccggctgggag
aaagatcctgtgcggatgattgaagcgtttgcctcagaaaaggtgacgaccgcgcatttt
attccggcaatggtcaacagctttttagacgcgctggaaacggagcctgaggaaacaaga
acacgcctcggcagaacactgacacgcgtgtttgccggaggcgaagctctttccccgctt
acggctgcccggtttgcagatctgttgccggagacgatgcttattcacggctatggaccg
acggaagcgacggttgatgcggcgttttacgtctgtgaccgaaaacgggacagcggacgg
acaaggcttccgatcggaaaacccgttccgggtgcccgtctgtatgtattagatagcggg
ggaaccatccagcctgcgggcgtggcaggagagctgtacatcgcggggaccggcgtggcc
cggggctatctgaaccggcctgagctgacagaggagcgttttctcgatgatccgttttac
ccgggagaacgcatgtatcagacgggtgatatcgcacgctggacagaagacggccttgtt
gaatggctcggccgttcagacggacaggtgaaagtccgcggctaccggattgaaccggga
gaaatcgaagcggcgatccggcgcatcgacggcattcgtgaggcggcggtcaccccccgg
accgaacacggcgaaaccgcgctttacgcctatatcgaaggacgggaaagcgatgacgtg
cgggcagagcttgcgacacgccttccggcctacatgatgccggctcagttcataaagatg
agcgaatggccggtcacgccgagcggaaagcttgaccgccgcgcgctgccggctcccggc
ggagcggcagacaccgccccgcggaacgtcacggaaatgaagctttgcgctctttgggaa
gaggtgctaaaaaacggccccgtcggcatccgggatcacttttttgagcggggcggccat
tcgttaaaagcgacggctctcgtctcccgcatcgccaaagagttcggtgttcaggtgccg
ttacaggacatcttcgcccggccgacggtggaagagcttgcttcggttattcaggacttg
gaagagagcccgtatgaagcgattcagcctgcgaaaaaacaggacacctatccggtgtct
tcggcgcagaaacggatgtatgtgctccagcagcttgaagatggcggtgtcggctacaat
atgccggctgtgctggaactgacgggcccgcttgaccgcagccggctggaggagacgttc
cggcagcttgtggagcggcatgagtcgctcagaacgtcctttgaaacggggcctgacggc
gaaccggtgcagcgcatccatgacagcgtaccgtttcagctggatgaggccgagtcagct
gacgcattcgtccggccgttttgtctggaggaagcgccgctcttccgtgcggctctcgtg
aaagaatccgacgaacgtcatcttttattaacggatatgcatcatattatttctgacggt
gtgtccgtcaacaccttgataaaagaattcggcgagctgtacgcaggccgttcgcttgcg
ccgatgcgccttcaatataaagactatgccgtctggcagcggtcgtttcaggagaaagaa
gggtaccagaaacaggaagcgtattggctgaagcggctagaaggagagctcccggtgctt
gagcttccggctgacaagccccgtccggcggtcagaagctttgcgggcggcagcgtatcg
tgcacgcttgacgctgaaacggcatccggccttcaccgcatcgcccgggatcacggctct
actttgtatatggtgcttctcgccgcgtacaatacgttactcgcgcgcctgagcgggcag
gaagacatcatcgtcggctcaccgattgccgggcgtccgcacaaagaccttgaaccgatt
ctcggcatgttcgtcaacacgctggccatcagaacggagccgaaaggagacaaacggttt
accgattacttggcggaagtccgccaggcggcgcttgaggcgtatgagcatcaagactac
ccgtttgaagagctggtggaacggctcggcgtacagcgggacatgagccgaaatccgctg
tttgacgttatgtttgtgctccaaaatatggagcgtgaatccctggtgttaaataagctg
catttggctcaagctgcggatacaagtcataaaaccgcaaagtttgatgccacgctttac
gcgtcagaagggtctgacggttccatcagctttgattttgaattcaatacagatatctat
caaaaacagacaattgaaaaatggctatcttattttacccgtattcttacaaaagtaatt
gaaaaccaagcgataccgcttggtgacattcacgtactggataatgctgaaacaaatcgc
gtcatttatcagtttaatcagacgaaaagcgattacccaagacacgaaaccatcagccgt
ttatttgagcggcaggcaaaagaaactcccgatgcccgggcagttgtttatgatggacaa
atcttgacataccgtgagctgaacgaacgggctaacagaatagcggcggctctccgatca
aatggcgtcggtccggaaagcgttgtcgccttattaaccggccgcacaacagagcttgcc
tccggaatcctcggaatattaaaagcggggggcgcctacttgcctatcggtgacgatgtg
ccgcgggaacgggctgaatggatgcttaaagactgtaaagctgatattcttctccaatct
gataaacttgacggtctgccgctttcaggaaaacgtttattcatagaggatattcaaaca
aaggccggattgagttcggaaaatcccgaaccgctcggcggacctgaatcgttggcctac
atgatttatacgtccgggtcaacaggtgcgccaaaaggcgtcatgattgaacagcgaagc
gtgatccgccttgtgaaaaacagcaattatattgattttacgccggaagatagactgttg
tttacttcatcattaggatttgacgttacgacatttgaaatattcggtccgcttttaaac
ggcgcttctttatatgtaagtgaccaggaaacctatctcgactctgatgttctggaaaca
tttatacagcaaaacggcattacgacactgtggctgacatcgtctctgttcaaccattta
tcagaacaaaatgaacacgtgttttccggattatcccgattgattatcggcggggaagca
ctgtccccgagccatgtaaaccgggttcggagtgcgctgccgcatctctcagtatggaat
ggatacggaccgactgaaaacacgacgttctcgacttgctttttgattgaacaatcatac
gatcattcaatcccgatcggccgcccagtcggaaattcaaccgcatatatcataaacagc
aggggaacaccgcagccgattggcgtcatcggcgaattatgcactggaggagacggtgtg
gcaagaggatacttcggccgccctgagctgacggaagaaaaatttgtccctaatcctttt
gttcccggagaacggatgtaccgcaccggagatttagcccgctggctgccggacggaacg
atcgaatatgccgggcggatggatgatcaagtgaaaatccgcggttatcgggtcgagctg
ggagagattgaagccgcactgaggagcctggacggcgtgaaagaagctgccgtgtcagtc
agaaccgggcagtccggcaataaagaactgatcgcatatatgagtctgcaggcggacatg
gatacagaaaaagtgcgttctttactttctcggcaactgccgaattacatggttccggcc
tatatgatggaacttgagaagctgccgcttacgccgaacggtaaattggatcggaaaaat
ctgcccgaaccggagctcgcgcttcaaaccgcgtacacagctccccgcaatgagcttgaa
gaacagctttccgtgatctggcaggaagtgctcggcacaaaacaagtcgggattgaggac
tcattttttgagttgggcggcgattcaatcaaagcgctgcaagtttccgcacggctcgga
cgctatgggtggaaaatgacggcaagtgacttattccggcacccgtccattaaggagctc
gcgcctcttatccggaaagcggaaagagtcagcgatcagcggccggtagaaggagacata
ccttggacacccgttcagcactggtttttatcacagcggatggaaaacagaaatcatttc
aatcagtccgtcatgatgttcagctctgacgcattgcataaacagccgctcaaagaagcc
ttgaagcatcttgtcattcatcatgatgcactccggatcaccgtcagtgcagaaaacgaa
agtttcagacaaatcaatcacggtattcaaaatgctgaactgtacagcttggacatttgg
gatctgtctgagacagatacttgggaaagagaaatagaaactgaagtggctgcgctccaa
cagcggatggatattgaaaaagggccgttattaaaagccggctggttcaaaacccggtcc
ggggattatttattcatcaccgtacatcacctggcggttgacggagtgtcatggcgtatt
ctgctggaggatttatctgccgcttacactcaagccgtaaaaggtcagccggtccagctt
ccgccaaagaccgattcgtttaaacaatacgccgtaaggctttcagaatacgcaaaaagc
agcaagctgatgcatgaagaagaatattggcgttttattgaagaagaaacagccgccgaa
cttccttatgaaaaaccgcagcatcagacgggagccgacagcattcggcaaacggtaagc
tttacgcttacagaagaagaaacgtccgttttgcttcagcaggtcaaccgggcctaccat
accgatacgcaagatattcttctgactgccgcagctttggctttacgggactggacaggg
ggcggcagattgcgcatcgcgatggaagggcacgggagagagcacatcatgccggagctc
gacatcagccgcaccgtaggctggtttacctccatgtatccggtgctcattgacttgaac
acagcaggcgctgagcttggaacggcggtaaaaacggtcaaagacacactcggaagaata
ccggataaaggaataggctacggcattttaaaatacatgacaccgcctgaacaaaaaaca
atccgcttcagacaagcgcctgaaatcagctttaactatttagggcaattcaatgataca
gaagatcagcacacgttcagtctgtccggtcttgcaagcgggcacgacatcacgccgaca
tggcagcgggaacaagcggtggaaatgagcgcgatggccgcacaaaacaaacttcacttc
agtttgagctatccgccgagccgcttccgcaaagaaacgatggaacagctgctgcaaacc
ttacagcaatatttgcgtgatattatggcgcactgcacagggaaagaggaagcagaaaaa
accgttagtgattttagcagcaaaacgttaacatctgatgatttggacagcatagcgagt
tttgtcgaggaactgtag

DBGET integrated database retrieval system