KEGG   Bacillus vallismortis: B9C48_17875
Entry
B9C48_17875       CDS       T04948                                 

Definition
(GenBank) bacilysin biosynthesis protein BacA
  KO
K19546  prephenate decarboxylase [EC:4.1.1.100]
Organism
bvm  Bacillus vallismortis
Pathway
bvm00998  Biosynthesis of various secondary metabolites - part 2
bvm01100  Metabolic pathways
bvm01110  Biosynthesis of secondary metabolites
Module
bvm_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bvm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    B9C48_17875
Enzymes [BR:bvm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.100  prephenate decarboxylase
     B9C48_17875
SSDB
Motif
Pfam: PDT
Other DBs
NCBI-ProteinID: ARM29593
UniProt: A0A1W6HMZ4
LinkDB
Position
complement(3611869..3612483)
AA seq 204 aa
MIILDNSIQTKSKAYSISKLITINTLGPEGTSSEYAAKNFITNFTLLQGVNSKLSLHDTF
ESCIEKTLQSPLEYTIVPHAYDGIKHFYMRPDLQLLQIFRCDTPMYGLAVRPGFEYTDDM
LEQAVIVSHPSPINLIKYFTRKDVTFDLVNSTSAAAKRVKDGLSDIALTNELARQKYGLH
FVKTFKSIPMSWSLFGKGEIHDEN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgattatattggataatagcattcaaacaaaaagcaaggcttattcaatatctaaactg
attacgatcaacacgctcggtcctgaagggacaagcagtgagtacgcagcaaaaaacttc
atcaccaattttacccttctccaaggggtgaacagcaaattatcactgcatgatacattt
gaatcgtgcattgaaaaaacgcttcaaagtccgctggaatacacaattgtgcctcacgcg
tatgacggcattaagcacttctacatgagaccggatctgcagcttctgcaaattttcagg
tgcgacaccccgatgtacggcctggctgtccggcccggttttgaatatacagatgacatg
cttgaacaggctgtcatcgtatcccacccgtctcctatcaatttgattaagtattttacc
cgtaaagatgtcacgtttgatctggtgaactcgacgagcgcagccgcgaaaagagtgaag
gacggtttgtccgacatcgcgctgacaaatgagctggccagacaaaagtacggccttcac
tttgtcaaaacatttaaaagcattcccatgagctggtcattattcggaaaaggagagatt
catgatgaaaactga

DBGET integrated database retrieval system