KEGG   Rossellomorea vietnamensis: FHE72_08125
Entry
FHE72_08125       CDS       T07200                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
bvq  Rossellomorea vietnamensis
Brite
KEGG Orthology (KO) [BR:bvq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bvq03000]
    FHE72_08125
Transcription factors [BR:bvq03000]
 Prokaryotic type
  Other transcription factors
   Others
    FHE72_08125
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_1 ABC_sub_bind Peripla_BP_6
Other DBs
NCBI-ProteinID: QHE60986
UniProt: A0A6I6URB0
LinkDB
Position
1563870..1564838
AA seq 322 aa
MNKKWYMFFLIVFLVGLSGCSAGNSEEIEKVGLLVPEAVNDGVWGTKGYKGLLKIQSDYH
ADVFYKEGMKNDTSIKQAVEEFDDKDVTLVFGHGSEYADVFNDLSGEHPNMHFVSFNGHA
TEKNTTSLQFKGYAMGFFGGMTAAFHSKTKKIGVIAAFEWQPEVQGFIDGAKYQNSETEV
KVEYTNHWDDQERALNELDTLLNEDIDVVYPAGDGYNVAVIEKLKEKGLYAIGYVSDQSD
LGESTVLTSTVQQADKLYAVVAERFAHDELESGNLEFDFEDGVISMGKFSPVIPKDFQSE
MKQHIKEYIDSGKLPNGKESKQ
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaataagaaatggtacatgtttttcctgattgtattcctggtcggactaagtggttgt
tcagcagggaacagcgaagagatagaaaaggttggtttacttgttccggaagcagtgaat
gatggagtttggggaacaaaaggttacaaaggattactaaaaatacaatccgattatcat
gcagacgtgttctataaagagggaatgaagaatgatacatcaatcaagcaggcagtagag
gaatttgatgataaggatgtcaccttagtatttggacatggaagtgagtatgcggatgtc
tttaacgacttgtcaggagagcatcccaatatgcatttcgtcagctttaacggacatgcc
acggagaaaaacacgacaagcctacagttcaaggggtacgctatgggctttttcggagga
atgacagcagcctttcactctaaaacgaaaaagatcggtgtgattgcggccttcgagtgg
cagccggaagttcaagggtttatagatggagcgaagtatcaaaacagtgagacagaggtt
aaagtagagtacaccaatcattgggacgatcaagagagggcccttaacgagttggacact
ttactaaacgaggatatcgatgttgtttatcctgcaggtgacggctataatgtagctgta
atcgaaaagcttaaggaaaaaggactgtatgccatagggtacgtatccgatcaatccgat
ctcggggaatcaacggtcctgacaagcacagttcaacaggcagataagttgtatgcagta
gtagccgagaggttcgcccatgatgagctggagtcaggcaacctggaattcgattttgaa
gacggtgtgatctccatggggaaattcagtccagtcattccaaaagattttcaatctgaa
atgaagcaacatatcaaggaatatattgactccggcaaattgccgaatggaaaggaatcg
aagcaatga

DBGET integrated database retrieval system